BLASTX nr result
ID: Stemona21_contig00011526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00011526 (2989 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P04373.4|COX2_ORYSJ RecName: Full=Cytochrome c oxidase subuni... 62 3e-17 gb|AFK93564.1| cytochrome c oxidase subunit 2, partial (mitochon... 62 3e-17 gb|AFK93566.1| cytochrome c oxidase subunit 2, partial (mitochon... 62 3e-17 gb|AFK93571.1| cytochrome c oxidase subunit 2, partial (mitochon... 62 3e-17 gb|AFK93565.1| cytochrome c oxidase subunit 2, partial (mitochon... 62 3e-17 gb|AFK93568.1| cytochrome c oxidase subunit 2, partial (mitochon... 62 3e-17 ref|YP_006280953.1| cytochrome c oxidase subunit 2 (mitochondrio... 60 1e-16 sp|P00413.2|COX2_WHEAT RecName: Full=Cytochrome c oxidase subuni... 60 5e-16 ref|YP_001661426.1| cytochrome c oxidase subunit 2 [Cycas taitun... 62 1e-15 gb|AEI98735.1| cytochrome oxidase subunit II [Rubus coreanus] 58 5e-15 gb|AAK32720.1| cytochrome c oxidase subunit II [Allium sativum] 59 4e-14 gb|ABX88962.1| cytochrome oxidase subunit II [Cajanus cajan] gi|... 58 1e-12 gb|ABX88949.1| cytochrome oxidase subunit II [Vigna radiata] 58 1e-12 gb|ABH11742.1| cytochrome c oxidase subunit 2 [Takakia ceratophy... 53 7e-11 ref|YP_514654.1| cytochrome c oxidase subunit 2 [Oryza sativa In... 68 1e-10 gb|ABY55206.1| cox2 [Bambusa oldhamii] gi|340748032|gb|AEK66749.... 68 1e-10 gb|AAA96602.1| CMS-associated fusion protein [Petunia axillaris ... 55 2e-10 gb|AAC00528.1| ORF379 (mitochondrion) [Petunia sp.] 55 2e-10 sp|P27168.1|COX2_DAUCA RecName: Full=Cytochrome c oxidase subuni... 67 2e-10 ref|YP_006291833.1| cox2 gene product (mitochondrion) [Daucus ca... 67 2e-10 >sp|P04373.4|COX2_ORYSJ RecName: Full=Cytochrome c oxidase subunit 2; AltName: Full=Cytochrome c oxidase polypeptide II gi|600446|emb|CAA25566.1| cytochrome C oxidase polypeptide II [Oryza sativa] Length = 260 Score = 61.6 bits (148), Expect(3) = 3e-17 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 127 WYRSYEYSDYNSSDEQSLTFDSYTIPEDDPEL 158 Score = 48.5 bits (114), Expect(3) = 3e-17 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 156 PELGQSRLLEVDNRVVVPAKTHLRM 180 Score = 27.7 bits (60), Expect(3) = 3e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 191 WAVPSSGVKCD 201 >gb|AFK93564.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Magnolia pyramidata] Length = 228 Score = 61.6 bits (148), Expect(3) = 3e-17 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 106 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 137 Score = 48.5 bits (114), Expect(3) = 3e-17 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 135 PELGQSRLLEVDNRVVVPAKTHLRM 159 Score = 27.7 bits (60), Expect(3) = 3e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 170 WAVPSSGVKCD 180 >gb|AFK93566.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Magnolia fordiana] Length = 223 Score = 61.6 bits (148), Expect(3) = 3e-17 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 106 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 137 Score = 48.5 bits (114), Expect(3) = 3e-17 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 135 PELGQSRLLEVDNRVVVPAKTHLRM 159 Score = 27.7 bits (60), Expect(3) = 3e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 170 WAVPSSGVKCD 180 >gb|AFK93571.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Magnolia tamaulipana] Length = 220 Score = 61.6 bits (148), Expect(3) = 3e-17 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 106 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 137 Score = 48.5 bits (114), Expect(3) = 3e-17 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 135 PELGQSRLLEVDNRVVVPAKTHLRM 159 Score = 27.7 bits (60), Expect(3) = 3e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 170 WAVPSSGVKCD 180 >gb|AFK93565.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Magnolia liliifera] Length = 218 Score = 61.6 bits (148), Expect(3) = 3e-17 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 106 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 137 Score = 48.5 bits (114), Expect(3) = 3e-17 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 135 PELGQSRLLEVDNRVVVPAKTHLRM 159 Score = 27.7 bits (60), Expect(3) = 3e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 170 WAVPSSGVKCD 180 >gb|AFK93568.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Magnolia cavaleriei] Length = 209 Score = 61.6 bits (148), Expect(3) = 3e-17 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 97 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 128 Score = 48.5 bits (114), Expect(3) = 3e-17 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 126 PELGQSRLLEVDNRVVVPAKTHLRM 150 Score = 27.7 bits (60), Expect(3) = 3e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 161 WAVPSSGVKCD 171 >ref|YP_006280953.1| cytochrome c oxidase subunit 2 (mitochondrion) [Spirodela polyrhiza] gi|385252655|gb|AFI54963.1| cytochrome c oxidase subunit 2 (mitochondrion) [Spirodela polyrhiza] Length = 243 Score = 59.7 bits (143), Expect(3) = 1e-16 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 127 WYWSYEYSDYNSSDEQSLTFDSYTIPEDDPEL 158 Score = 48.5 bits (114), Expect(3) = 1e-16 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 156 PELGQSRLLEVDNRVVVPAKTHLRM 180 Score = 27.7 bits (60), Expect(3) = 1e-16 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 191 WAVPSSGVKCD 201 >sp|P00413.2|COX2_WHEAT RecName: Full=Cytochrome c oxidase subunit 2; AltName: Full=Cytochrome c oxidase polypeptide II Length = 260 Score = 59.7 bits (143), Expect(3) = 5e-16 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 127 WYWTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 158 Score = 48.5 bits (114), Expect(3) = 5e-16 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 156 PELGQSRLLEVDNRVVVPAKTHLRM 180 Score = 25.4 bits (54), Expect(3) = 5e-16 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPS GVKCD Sbjct: 191 WAVPSLGVKCD 201 >ref|YP_001661426.1| cytochrome c oxidase subunit 2 [Cycas taitungensis] gi|166706964|dbj|BAF98428.1| cytochrome c oxidase subunit 2 [Cycas taitungensis] Length = 268 Score = 61.6 bits (148), Expect(3) = 1e-15 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 125 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPEL 156 Score = 47.4 bits (111), Expect(3) = 1e-15 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPA+THL M Sbjct: 154 PELGQSRLLEVDNRVVVPARTHLRM 178 Score = 23.5 bits (49), Expect(3) = 1e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 1454 VPSSGVKCD 1428 VPSSGVKCD Sbjct: 191 VPSSGVKCD 199 >gb|AEI98735.1| cytochrome oxidase subunit II [Rubus coreanus] Length = 255 Score = 57.8 bits (138), Expect(3) = 5e-15 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDN 1553 W + YEYSDYNSSDEQSLTFD+YTIPED+ Sbjct: 125 WYRTYEYSDYNSSDEQSLTFDSYTIPEDD 153 Score = 44.7 bits (104), Expect(3) = 5e-15 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 1548 KLGQSRLLEVDNRVVVPAKTHL 1483 +LGQSRLLEVDNRVVVPAKTHL Sbjct: 155 ELGQSRLLEVDNRVVVPAKTHL 176 Score = 27.7 bits (60), Expect(3) = 5e-15 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 189 WAVPSSGVKCD 199 >gb|AAK32720.1| cytochrome c oxidase subunit II [Allium sativum] Length = 64 Score = 59.3 bits (142), Expect(2) = 4e-14 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -1 Query: 1633 KPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 +PYEYSDYNSSD+QSLTFD+YTIPED+P++ Sbjct: 3 QPYEYSDYNSSDDQSLTFDSYTIPEDDPEL 32 Score = 48.5 bits (114), Expect(2) = 4e-14 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHLLM 1477 P+LGQSRLLEVDNRVVVPAKTHL M Sbjct: 30 PELGQSRLLEVDNRVVVPAKTHLRM 54 >gb|ABX88962.1| cytochrome oxidase subunit II [Cajanus cajan] gi|162405456|gb|ABX88963.1| cytochrome oxidase subunit II [Cajanus cajan] Length = 119 Score = 57.8 bits (138), Expect(2) = 1e-12 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDN 1553 W + YEYSDYNSSDEQSLTFD+YTIPED+ Sbjct: 57 WYRTYEYSDYNSSDEQSLTFDSYTIPEDD 85 Score = 44.7 bits (104), Expect(2) = 1e-12 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 1548 KLGQSRLLEVDNRVVVPAKTHL 1483 +LGQSRLLEVDNRVVVPAKTHL Sbjct: 87 ELGQSRLLEVDNRVVVPAKTHL 108 >gb|ABX88949.1| cytochrome oxidase subunit II [Vigna radiata] Length = 117 Score = 57.8 bits (138), Expect(2) = 1e-12 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDN 1553 W + YEYSDYNSSDEQSLTFD+YTIPED+ Sbjct: 56 WYRTYEYSDYNSSDEQSLTFDSYTIPEDD 84 Score = 44.7 bits (104), Expect(2) = 1e-12 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 1548 KLGQSRLLEVDNRVVVPAKTHL 1483 +LGQSRLLEVDNRVVVPAKTHL Sbjct: 86 ELGQSRLLEVDNRVVVPAKTHL 107 >gb|ABH11742.1| cytochrome c oxidase subunit 2 [Takakia ceratophylla] Length = 119 Score = 53.1 bits (126), Expect(2) = 7e-11 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 W + YEYSDYNSSDEQSLT D+Y IPED+ ++ Sbjct: 4 WYRTYEYSDYNSSDEQSLTSDSYMIPEDDSEL 35 Score = 43.5 bits (101), Expect(2) = 7e-11 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 1548 KLGQSRLLEVDNRVVVPAKTHLLMYL 1471 +LGQSRLLEVDNRVVVPAKTH M + Sbjct: 34 ELGQSRLLEVDNRVVVPAKTHPRMII 59 >ref|YP_514654.1| cytochrome c oxidase subunit 2 [Oryza sativa Indica Group] gi|74100073|gb|AAZ99237.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza sativa Indica Group] gi|74100128|gb|AAZ99291.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100182|gb|AAZ99344.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza sativa Japonica Group] gi|353685263|gb|AER13026.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza sativa Indica Group] gi|353685336|gb|AER13098.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza sativa Indica Group] gi|528540434|dbj|BAN67488.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540442|dbj|BAN67496.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540453|dbj|BAN67507.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540482|dbj|BAN67535.1| cytochrome c oxidase subunit 2 (mitochondrion) [Oryza rufipogon] Length = 260 Score = 68.2 bits (165), Expect(2) = 1e-10 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKIRSITFIRSGQ*SGCTSQN------SSAD 1478 W +PYEYSDYNSSDEQSLTFD+YTIPED+P++ + ++ + AD Sbjct: 127 WYRPYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPAD 186 Query: 1477 VPHNW 1463 VPH+W Sbjct: 187 VPHSW 191 Score = 27.7 bits (60), Expect(2) = 1e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 191 WAVPSSGVKCD 201 >gb|ABY55206.1| cox2 [Bambusa oldhamii] gi|340748032|gb|AEK66749.1| cytochrome c oxidase subunit 2 [Ferrocalamus rimosivaginus] gi|372861965|gb|AEX98109.1| cytochrome c oxidase subunit 2 (mitochondrion) [Ferrocalamus rimosivaginus] Length = 260 Score = 68.2 bits (165), Expect(2) = 1e-10 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKIRSITFIRSGQ*SGCTSQN------SSAD 1478 W +PYEYSDYNSSDEQSLTFD+YTIPED+P++ + ++ + AD Sbjct: 127 WYRPYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPAD 186 Query: 1477 VPHNW 1463 VPH+W Sbjct: 187 VPHSW 191 Score = 27.7 bits (60), Expect(2) = 1e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 191 WAVPSSGVKCD 201 >gb|AAA96602.1| CMS-associated fusion protein [Petunia axillaris subsp. parodii] Length = 402 Score = 54.7 bits (130), Expect(2) = 2e-10 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 1627 YEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 Y YSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 109 YGYSDYNSSDEQSLTFDSYTIPEDDPEL 136 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHL 1483 P+LGQSRLLEVDNRVVVPA + L Sbjct: 134 PELGQSRLLEVDNRVVVPANSSL 156 >gb|AAC00528.1| ORF379 (mitochondrion) [Petunia sp.] Length = 379 Score = 54.7 bits (130), Expect(2) = 2e-10 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 1627 YEYSDYNSSDEQSLTFDNYTIPEDNPKI 1544 Y YSDYNSSDEQSLTFD+YTIPED+P++ Sbjct: 86 YGYSDYNSSDEQSLTFDSYTIPEDDPEL 113 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 1551 PKLGQSRLLEVDNRVVVPAKTHL 1483 P+LGQSRLLEVDNRVVVPA + L Sbjct: 111 PELGQSRLLEVDNRVVVPANSSL 133 >sp|P27168.1|COX2_DAUCA RecName: Full=Cytochrome c oxidase subunit 2; AltName: Full=Cytochrome c oxidase polypeptide II gi|18332|emb|CAA45171.1| cytochrome c oxidase subunit II [Daucus carota] Length = 261 Score = 67.0 bits (162), Expect(2) = 2e-10 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKIRSITFIRSGQ*SGCTSQN------SSAD 1478 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ + ++ +SAD Sbjct: 126 WYRTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRIIVTSAD 185 Query: 1477 VPHNW 1463 VPH+W Sbjct: 186 VPHSW 190 Score = 27.7 bits (60), Expect(2) = 2e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 190 WAVPSSGVKCD 200 >ref|YP_006291833.1| cox2 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081950|gb|AEY81142.1| cytochrome oxidase subunit 2 (mitochondrion) [Daucus carota subsp. sativus] Length = 259 Score = 67.0 bits (162), Expect(2) = 2e-10 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = -1 Query: 1639 WLKPYEYSDYNSSDEQSLTFDNYTIPEDNPKIRSITFIRSGQ*SGCTSQN------SSAD 1478 W + YEYSDYNSSDEQSLTFD+YTIPED+P++ + ++ +SAD Sbjct: 126 WYRSYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRIIVTSAD 185 Query: 1477 VPHNW 1463 VPH+W Sbjct: 186 VPHSW 190 Score = 27.7 bits (60), Expect(2) = 2e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 1460 WVVPSSGVKCD 1428 W VPSSGVKCD Sbjct: 190 WAVPSSGVKCD 200