BLASTX nr result
ID: Stemona21_contig00011293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00011293 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006303421.1| hypothetical protein CARUB_v10010630mg [Caps... 81 2e-13 ref|NP_564325.1| Alba DNA/RNA-binding protein [Arabidopsis thali... 81 2e-13 ref|XP_002890797.1| nucleic acid binding protein [Arabidopsis ly... 81 2e-13 ref|XP_002524472.1| conserved hypothetical protein [Ricinus comm... 80 3e-13 gb|EOY31030.1| Alba DNA/RNA-binding protein [Theobroma cacao] 80 4e-13 ref|NP_565781.1| Alba DNA/RNA-binding protein [Arabidopsis thali... 79 8e-13 ref|XP_002879480.1| nucleic acid binding protein [Arabidopsis ly... 78 1e-12 ref|XP_006415602.1| hypothetical protein EUTSA_v10009096mg [Eutr... 78 1e-12 ref|XP_004168112.1| PREDICTED: uncharacterized protein At2g34160... 78 1e-12 ref|XP_004150019.1| PREDICTED: uncharacterized protein At2g34160... 78 1e-12 gb|EXB53734.1| Uncharacterized protein L484_022390 [Morus notabi... 77 2e-12 ref|XP_006295225.1| hypothetical protein CARUB_v10024310mg [Caps... 77 2e-12 ref|XP_006450953.1| hypothetical protein CICLE_v10009883mg [Citr... 77 2e-12 ref|XP_006410558.1| hypothetical protein EUTSA_v10017416mg [Eutr... 76 4e-12 ref|XP_004968373.1| PREDICTED: uncharacterized protein At2g34160... 75 9e-12 ref|XP_002515535.1| conserved hypothetical protein [Ricinus comm... 75 9e-12 ref|XP_004965953.1| PREDICTED: uncharacterized protein At2g34160... 75 1e-11 dbj|BAJ98262.1| predicted protein [Hordeum vulgare subsp. vulgar... 75 1e-11 ref|XP_002437246.1| hypothetical protein SORBIDRAFT_10g023460 [S... 75 1e-11 gb|EXB67321.1| Uncharacterized protein L484_025803 [Morus notabi... 74 2e-11 >ref|XP_006303421.1| hypothetical protein CARUB_v10010630mg [Capsella rubella] gi|482572132|gb|EOA36319.1| hypothetical protein CARUB_v10010630mg [Capsella rubella] Length = 130 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVNN+++ +TQKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNNMNLAVDTQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|NP_564325.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana] gi|9502415|gb|AAF88114.1|AC021043_7 Unknown protein [Arabidopsis thaliana] gi|15529270|gb|AAK97729.1| At1g29250/F28N24_8 [Arabidopsis thaliana] gi|16974409|gb|AAL31130.1| At1g29250/F28N24_8 [Arabidopsis thaliana] gi|21553922|gb|AAM63005.1| unknown [Arabidopsis thaliana] gi|332192944|gb|AEE31065.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana] Length = 130 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVNN+++ +TQKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNNMNLAVDTQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_002890797.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297336639|gb|EFH67056.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Length = 130 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVNN+++ +TQKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNNMNLAVDTQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_002524472.1| conserved hypothetical protein [Ricinus communis] gi|223536260|gb|EEF37912.1| conserved hypothetical protein [Ricinus communis] Length = 130 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVNN+++ G+ KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNNINLAGDLHKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >gb|EOY31030.1| Alba DNA/RNA-binding protein [Theobroma cacao] Length = 130 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEIT+GVNN+++G ++ KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITQGVNNMNLGADSHKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|NP_565781.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana] gi|73921087|sp|O22969.1|Y2416_ARATH RecName: Full=Uncharacterized protein At2g34160 gi|2342735|gb|AAB67633.1| expressed protein [Arabidopsis thaliana] gi|21536653|gb|AAM60985.1| unknown [Arabidopsis thaliana] gi|26450089|dbj|BAC42164.1| unknown protein [Arabidopsis thaliana] gi|111074476|gb|ABH04611.1| At2g34160 [Arabidopsis thaliana] gi|330253832|gb|AEC08926.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana] Length = 130 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEIT+GVNN+++ ++QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITDGVNNMNLATDSQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_002879480.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297325319|gb|EFH55739.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Length = 130 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEIT+GVNN+++ ++QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITDGVNNMNLAVDSQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_006415602.1| hypothetical protein EUTSA_v10009096mg [Eutrema salsugineum] gi|557093373|gb|ESQ33955.1| hypothetical protein EUTSA_v10009096mg [Eutrema salsugineum] Length = 130 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 ME ITEGVNN+S+ ++QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEGITEGVNNMSLAVDSQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_004168112.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus] Length = 129 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVN++++ ++QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNSITLTADSQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_004150019.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus] Length = 130 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVN++++ ++QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNSITLTADSQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >gb|EXB53734.1| Uncharacterized protein L484_022390 [Morus notabilis] Length = 131 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 1/45 (2%) Frame = +3 Query: 147 MEEITEGVNNLSVG-GETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVN +++G G+T KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNAINIGSGDTYKKNRIQVSNTKKPLFFYVNLAKRYMQ 45 >ref|XP_006295225.1| hypothetical protein CARUB_v10024310mg [Capsella rubella] gi|482563933|gb|EOA28123.1| hypothetical protein CARUB_v10024310mg [Capsella rubella] Length = 130 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEIT+GV+N+++ ++QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITDGVSNMNLANDSQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_006450953.1| hypothetical protein CICLE_v10009883mg [Citrus clementina] gi|568843876|ref|XP_006475824.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis] gi|557554179|gb|ESR64193.1| hypothetical protein CICLE_v10009883mg [Citrus clementina] Length = 130 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEITEGVNN+++ + KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITEGVNNMNLAVDANKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_006410558.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum] gi|557111727|gb|ESQ52011.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum] Length = 130 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEIT GVNN+++ + QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITAGVNNMNLAVDDQKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_004968373.1| PREDICTED: uncharacterized protein At2g34160-like isoform X3 [Setaria italica] Length = 134 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 +EEITEGV NLSV G+ NRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 3 VEEITEGVKNLSVAGDAAASNRIQVSNTKKPLFFYVNLAKRYMQ 46 >ref|XP_002515535.1| conserved hypothetical protein [Ricinus communis] gi|223545479|gb|EEF46984.1| conserved hypothetical protein [Ricinus communis] Length = 128 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 ME +TEGVNN+++ + KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEAVTEGVNNMNINDASNKKNRIQVSNTKKPLFFYVNLAKRYMQ 44 >ref|XP_004965953.1| PREDICTED: uncharacterized protein At2g34160-like [Setaria italica] Length = 130 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEE+TEGVNNL++ E KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEVTEGVNNLAIT-EPHKKNRIQVSNTKKPLFFYVNLAKRYMQ 43 >dbj|BAJ98262.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326521236|dbj|BAJ96821.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 132 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEE+TEGV NL+V E QKKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEVTEGVKNLAVT-EPQKKNRIQVSNTKKPLFFYVNLAKRYMQ 43 >ref|XP_002437246.1| hypothetical protein SORBIDRAFT_10g023460 [Sorghum bicolor] gi|241915469|gb|EER88613.1| hypothetical protein SORBIDRAFT_10g023460 [Sorghum bicolor] Length = 129 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEE+TEGVNNL++ E KKNRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEVTEGVNNLAIT-EPHKKNRIQVSNTKKPLFFYVNLAKRYMQ 43 >gb|EXB67321.1| Uncharacterized protein L484_025803 [Morus notabilis] Length = 129 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 147 MEEITEGVNNLSVGGETQKKNRIQVSNTKKPLFFYVNLAKRYMQ 278 MEEIT+GVNN+++ ++QK+NRIQVSNTKKPLFFYVNLAKRYMQ Sbjct: 1 MEEITDGVNNINIS-DSQKRNRIQVSNTKKPLFFYVNLAKRYMQ 43