BLASTX nr result
ID: Stemona21_contig00010946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00010946 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC29957.1| Thioredoxin F-type [Morus notabilis] 67 2e-09 ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 67 3e-09 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 67 3e-09 sp|P29450.1|TRXF_PEA RecName: Full=Thioredoxin F-type, chloropla... 66 4e-09 ref|XP_004492848.1| PREDICTED: thioredoxin F-type, chloroplastic... 65 1e-08 gb|AFK48258.1| unknown [Lotus japonicus] 64 2e-08 gb|AFK37418.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vit... 63 4e-08 gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus... 62 6e-08 ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-lik... 62 8e-08 ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycin... 62 8e-08 ref|XP_006852197.1| hypothetical protein AMTR_s00049p00119540 [A... 62 1e-07 ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, part... 61 1e-07 ref|NP_001045167.1| Os01g0913000 [Oryza sativa Japonica Group] g... 61 1e-07 ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus commun... 61 2e-07 ref|NP_001235872.1| uncharacterized protein LOC100499776 [Glycin... 60 2e-07 gb|EOY09777.1| Thioredoxin F-type 1 [Theobroma cacao] 60 3e-07 gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] 60 3e-07 ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] gi|... 60 3e-07 ref|XP_006408388.1| hypothetical protein EUTSA_v10021615mg [Eutr... 60 4e-07 >gb|EXC29957.1| Thioredoxin F-type [Morus notabilis] Length = 184 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILKDSK+VKEVTGAKFDDLV+AIDTV+SS Sbjct: 149 RVVPTFKILKDSKIVKEVTGAKFDDLVVAIDTVRSS 184 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKDSK+VKEVTGAK+DDLV AIDTV+SS Sbjct: 147 KVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRSS 182 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKDSK+VKEVTGAK+DDLV AIDTV+SS Sbjct: 151 KVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRSS 186 >sp|P29450.1|TRXF_PEA RecName: Full=Thioredoxin F-type, chloroplastic; Short=Trx-F; Flags: Precursor gi|20907|emb|CAA45098.1| thioredoxin F [Pisum sativum] gi|1388086|gb|AAC49357.1| thioredoxin f [Pisum sativum] Length = 182 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKD+K+VKEVTGAKFDDLV AIDTV+SS Sbjct: 147 KVVPTFKILKDNKIVKEVTGAKFDDLVAAIDTVRSS 182 >ref|XP_004492848.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Cicer arietinum] Length = 181 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKDSKVVKEVTGAK+DDLV AI+TV+SS Sbjct: 146 KVVPTFKILKDSKVVKEVTGAKYDDLVAAINTVRSS 181 >gb|AFK48258.1| unknown [Lotus japonicus] Length = 179 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKDSK+VKE+TGAK+DDLV AI+TV+SS Sbjct: 144 KVVPTFKILKDSKIVKEITGAKYDDLVAAIETVRSS 179 >gb|AFK37418.1| unknown [Lotus japonicus] Length = 179 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKDSK+VKE+TGAK+DDLV AI+TV+SS Sbjct: 144 KVVPTFKILKDSKIVKEITGAKYDDLVAAIETVRSS 179 >ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vitis vinifera] gi|297735248|emb|CBI17610.3| unnamed protein product [Vitis vinifera] Length = 172 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILKDSK+VKEVTGAK DDLV+AI+TV+SS Sbjct: 137 RVVPTFKILKDSKIVKEVTGAKLDDLVVAIETVRSS 172 >gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] Length = 181 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKD+KVVKEVTGAKFDDLV AID V+ S Sbjct: 146 KVVPTFKILKDNKVVKEVTGAKFDDLVAAIDNVRLS 181 >ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] gi|449476195|ref|XP_004154668.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] Length = 180 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKD KVVKEVTGAKFD+LV AID V+SS Sbjct: 145 KVVPTFKILKDKKVVKEVTGAKFDELVHAIDAVRSS 180 >ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycine max] gi|255628867|gb|ACU14778.1| unknown [Glycine max] Length = 179 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKD+KVVKEVTGAK+DDLV AID V+SS Sbjct: 144 KVVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRSS 179 >ref|XP_006852197.1| hypothetical protein AMTR_s00049p00119540 [Amborella trichopoda] gi|548855801|gb|ERN13664.1| hypothetical protein AMTR_s00049p00119540 [Amborella trichopoda] Length = 181 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILK++KVVKEVTGAK DDLV AIDTV+SS Sbjct: 145 RVVPTFKILKENKVVKEVTGAKLDDLVAAIDTVRSS 180 >ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] gi|482567257|gb|EOA31446.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] Length = 209 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILKD+KVVKEVTGAK+DDLV AI+T +SS Sbjct: 170 RVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSS 205 >ref|NP_001045167.1| Os01g0913000 [Oryza sativa Japonica Group] gi|75330816|sp|Q8S091.1|TRXF_ORYSJ RecName: Full=Thioredoxin F, chloroplastic; Short=OsTrxf; AltName: Full=OsTrx03; Flags: Precursor gi|20161376|dbj|BAB90300.1| putative thioredoxin F [Oryza sativa Japonica Group] gi|113534698|dbj|BAF07081.1| Os01g0913000 [Oryza sativa Japonica Group] gi|125528816|gb|EAY76930.1| hypothetical protein OsI_04888 [Oryza sativa Indica Group] gi|125573075|gb|EAZ14590.1| hypothetical protein OsJ_04513 [Oryza sativa Japonica Group] gi|215715230|dbj|BAG94981.1| unnamed protein product [Oryza sativa Japonica Group] Length = 187 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 KVVPTFKILKD KVVKEVTGAK D+L+ AI+TVKSS Sbjct: 152 KVVPTFKILKDGKVVKEVTGAKLDELIQAIETVKSS 187 >ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Length = 186 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILKD+KVVKEVTG+KFDDLV AI+ V+SS Sbjct: 151 RVVPTFKILKDNKVVKEVTGSKFDDLVAAIEAVRSS 186 >ref|NP_001235872.1| uncharacterized protein LOC100499776 [Glycine max] gi|255626459|gb|ACU13574.1| unknown [Glycine max] Length = 181 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 K VPTFKILKD+KVVKEVTGAK+DDLV AID V+SS Sbjct: 146 KAVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRSS 181 >gb|EOY09777.1| Thioredoxin F-type 1 [Theobroma cacao] Length = 189 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILK K+VKEV GAKFDDLVLAI+TV+SS Sbjct: 154 RVVPTFKILKHKKIVKEVKGAKFDDLVLAIETVRSS 189 >gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] Length = 178 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILKD+KVVKEVTGAK+DDLV AI+T +S+ Sbjct: 140 RVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSA 175 >ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] gi|27735269|sp|Q9XFH8.2|TRXF1_ARATH RecName: Full=Thioredoxin F1, chloroplastic; Short=AtTrxf1; AltName: Full=Thioredoxin F2; Short=AtTrxf2; Flags: Precursor gi|6728989|gb|AAF26987.1|AC018363_32 thioredoxin f1 [Arabidopsis thaliana] gi|17529210|gb|AAL38832.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|20466041|gb|AAM20355.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|21537004|gb|AAM61345.1| thioredoxin f1 [Arabidopsis thaliana] gi|332640331|gb|AEE73852.1| thioredoxin F-type 1 [Arabidopsis thaliana] Length = 178 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKSS 110 +VVPTFKILKD+KVVKEVTGAK+DDLV AI+T +S+ Sbjct: 140 RVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSA 175 >ref|XP_006408388.1| hypothetical protein EUTSA_v10021615mg [Eutrema salsugineum] gi|557109534|gb|ESQ49841.1| hypothetical protein EUTSA_v10021615mg [Eutrema salsugineum] Length = 181 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 3 KVVPTFKILKDSKVVKEVTGAKFDDLVLAIDTVKS 107 +VVPTFKILKD+KVVKEVTGAK+DDLV AI+T +S Sbjct: 143 RVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARS 177