BLASTX nr result
ID: Stemona21_contig00010804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00010804 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 91 2e-16 gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Mor... 88 1e-15 gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus pe... 88 1e-15 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 88 1e-15 gb|AFK44684.1| unknown [Lotus japonicus] 87 2e-15 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 87 2e-15 ref|XP_006473187.1| PREDICTED: mitochondrial import receptor sub... 86 5e-15 ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citr... 86 7e-15 ref|XP_004299770.1| PREDICTED: mitochondrial import receptor sub... 86 7e-15 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 86 7e-15 ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 86 7e-15 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 85 9e-15 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 85 1e-14 ref|XP_006477861.1| PREDICTED: mitochondrial import receptor sub... 84 1e-14 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 84 2e-14 ref|XP_006360661.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 ref|XP_004969224.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 ref|XP_004503550.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 gb|ABK21382.1| unknown [Picea sitchensis] 84 3e-14 ref|XP_006405320.1| hypothetical protein EUTSA_v10028124mg [Eutr... 83 3e-14 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 ST++C+ EWSTWT+KKAKVITHYGFIPL+++IGMNSEPKP + QLL+PV Sbjct: 27 STIQCLKEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Morus notabilis] Length = 71 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 ST + V EW+TW KKAKVITHYGFIPL+I+IGMNS+PKPH+SQLLSPV Sbjct: 23 STAQLVKEWTTWAAKKAKVITHYGFIPLVIIIGMNSDPKPHLSQLLSPV 71 >gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S + V EWSTW MKKAKV+THYGFIPLIIVIGMNSEPKP +SQLLSPV Sbjct: 25 SVAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 +TVR V EW+TWTMKKAKV+ HYGFIPL+IVIGMNSEPKP + QLLSPV Sbjct: 31 TTVRLVKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 87.0 bits (214), Expect = 2e-15 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = +3 Query: 117 CVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 C+ EW+TWTM+KAKV+THYGFIPLII+IGMNS+PKP +SQLLSPV Sbjct: 28 CLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 +TVR + EW+TWTMKKAKV+ HYGFIPL+IVIGMNSEPKP + QLLSPV Sbjct: 31 TTVRLMKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_006473187.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 71 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S C+ EWSTW MKKAKVITHYGFIPL+I+IGMNS+PKP + QLLSPV Sbjct: 23 SRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71 >ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|567884091|ref|XP_006434604.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536725|gb|ESR47843.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536726|gb|ESR47844.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S C+ EWSTW MKKAKVITHYGFIPL+I+IGMNS+PKP + QLLSPV Sbjct: 23 SRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQLLSPV 71 >ref|XP_004299770.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S + V EW+ WTMKKAKV+THYGFIPLII+IGMNS+PKP +SQLLSPV Sbjct: 25 SITQAVKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S C+ EW+TW M+KAKVITHYGFIPL+IVIGMNS+PKP +SQLLSPV Sbjct: 24 SASECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Vitis vinifera] Length = 73 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 ST +C+ +WS W +KKAKVITHYGFIP++I+IGMNSEPKP + QLLSPV Sbjct: 25 STAKCLKDWSNWALKKAKVITHYGFIPMVIIIGMNSEPKPQLYQLLSPV 73 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S C+ EW+TW M+KAKVITHYGFIPL+I+IGMNS+PKP +SQLLSPV Sbjct: 24 SASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S V EWSTWTMKKAKV+THYGFIPLII+IGMNS+PKP + QLLSPV Sbjct: 24 SMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_006477861.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 72 Score = 84.3 bits (207), Expect = 1e-14 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S + EWSTWTMKKAKV+THYGFIPLII+IGMNS+PKP + QLLSPV Sbjct: 24 SMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 120 VNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 V EW TWT KKAKVITHYGFIPL+I+IGMNSEPKP +SQLLSPV Sbjct: 29 VKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >ref|XP_006360661.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 120 VNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 V +WSTWT KKAKVITHYGFIPL+I++GMNSEPKP +SQLLSPV Sbjct: 35 VKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_004969224.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Setaria italica] Length = 82 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 + VR V EW+TWTMK AKV HYGFIPL+I+IGMNS+PKP ISQLLSPV Sbjct: 34 TAVRLVKEWTTWTMKTAKVAAHYGFIPLVIIIGMNSDPKPSISQLLSPV 82 >ref|XP_004503550.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cicer arietinum] Length = 72 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S V C+ EW+TW ++KAKVITHYGFIP+II+IGMNS+PKP +SQLLSPV Sbjct: 24 SYVDCMKEWTTWGLRKAKVITHYGFIPMIILIGMNSDPKPQLSQLLSPV 72 >gb|ABK21382.1| unknown [Picea sitchensis] Length = 72 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S + V EW+TW MK+AK +THYGFIPL+I+IGMNSEPKP I+QLLSPV Sbjct: 24 SATKAVKEWTTWVMKRAKTVTHYGFIPLVIIIGMNSEPKPSIAQLLSPV 72 >ref|XP_006405320.1| hypothetical protein EUTSA_v10028124mg [Eutrema salsugineum] gi|557106458|gb|ESQ46773.1| hypothetical protein EUTSA_v10028124mg [Eutrema salsugineum] Length = 71 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +3 Query: 105 STVRCVNEWSTWTMKKAKVITHYGFIPLIIVIGMNSEPKPHISQLLSPV 251 S ++ V EWS W++KKAKV THYGFIPLII+IGMNS+PKPH+ QLLSPV Sbjct: 23 SKLQVVKEWSNWSLKKAKVATHYGFIPLIIIIGMNSDPKPHLFQLLSPV 71