BLASTX nr result
ID: Stemona21_contig00010189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00010189 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494066.1| PREDICTED: thioredoxin-like 3-3-like [Cicer ... 119 5e-25 ref|XP_002519481.1| Thioredoxin, putative [Ricinus communis] gi|... 117 2e-24 gb|AFK40302.1| unknown [Lotus japonicus] 117 2e-24 ref|XP_003625683.1| Thioredoxin-like protein [Medicago truncatul... 117 2e-24 gb|AFH68078.1| thioredoxin-like protein 1 [Populus tremula x Pop... 114 1e-23 ref|XP_002326377.1| predicted protein [Populus trichocarpa] gi|5... 114 1e-23 gb|EXB75879.1| Thioredoxin-like 3-3 [Morus notabilis] 114 1e-23 gb|ESW34771.1| hypothetical protein PHAVU_001G179600g [Phaseolus... 114 1e-23 ref|XP_006448411.1| hypothetical protein CICLE_v10017163mg [Citr... 114 1e-23 ref|XP_002266281.2| PREDICTED: thioredoxin-like 3-3-like [Vitis ... 113 2e-23 gb|EMJ05214.1| hypothetical protein PRUPE_ppa020010mg [Prunus pe... 112 4e-23 ref|NP_566982.1| thioredoxin-like 3-3 [Arabidopsis thaliana] gi|... 112 4e-23 ref|XP_004246620.1| PREDICTED: thioredoxin-like 3-3-like isoform... 112 7e-23 ref|XP_004246619.1| PREDICTED: thioredoxin-like 3-3-like isoform... 112 7e-23 ref|XP_004246618.1| PREDICTED: thioredoxin-like 3-3-like isoform... 112 7e-23 gb|EOY07937.1| Thioredoxin superfamily protein [Theobroma cacao] 111 1e-22 ref|XP_004304468.1| PREDICTED: thioredoxin-like 3-3-like [Fragar... 111 1e-22 ref|XP_006354375.1| PREDICTED: thioredoxin-like 3-3-like [Solanu... 110 1e-22 ref|XP_004143273.1| PREDICTED: thioredoxin-like 3-3-like [Cucumi... 110 2e-22 ref|XP_002876194.1| thioredoxin family protein [Arabidopsis lyra... 110 2e-22 >ref|XP_004494066.1| PREDICTED: thioredoxin-like 3-3-like [Cicer arietinum] Length = 141 Score = 119 bits (297), Expect = 5e-25 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN+FPKLSFVYADIDECPETTQ IRYTPTFQFFRDGEKVDEM+G GE+RLHDRLWLHS Sbjct: 84 SNKFPKLSFVYADIDECPETTQHIRYTPTFQFFRDGEKVDEMYGTGEERLHDRLWLHS 141 >ref|XP_002519481.1| Thioredoxin, putative [Ricinus communis] gi|223541344|gb|EEF42895.1| Thioredoxin, putative [Ricinus communis] Length = 127 Score = 117 bits (293), Expect = 2e-24 Identities = 50/58 (86%), Positives = 57/58 (98%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN+FPKLSF+YADIDECPETTQ +RYTPTFQF+RDGE+VDEM+GAGE+RLHDRLWLHS Sbjct: 70 SNKFPKLSFIYADIDECPETTQHVRYTPTFQFYRDGERVDEMYGAGEERLHDRLWLHS 127 >gb|AFK40302.1| unknown [Lotus japonicus] Length = 137 Score = 117 bits (292), Expect = 2e-24 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN+FPKLSF+YADIDECPETTQ IRYTPTFQFFRDGEKVDEM+G GEQRL DRLWLHS Sbjct: 80 SNDFPKLSFIYADIDECPETTQHIRYTPTFQFFRDGEKVDEMYGTGEQRLRDRLWLHS 137 >ref|XP_003625683.1| Thioredoxin-like protein [Medicago truncatula] gi|355500698|gb|AES81901.1| Thioredoxin-like protein [Medicago truncatula] Length = 128 Score = 117 bits (292), Expect = 2e-24 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN+FPKLSF+YADIDECPETTQ IRYTPTFQFFR+GEKVDEM+G GE+RLHDRLWLHS Sbjct: 71 SNKFPKLSFIYADIDECPETTQQIRYTPTFQFFRNGEKVDEMYGTGEERLHDRLWLHS 128 >gb|AFH68078.1| thioredoxin-like protein 1 [Populus tremula x Populus tremuloides] Length = 128 Score = 114 bits (286), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPKLSFVYADIDECPETTQ IRYTPTF F+RDGE+VDEM GAGE+RLHDRLWLHS Sbjct: 71 SNNFPKLSFVYADIDECPETTQHIRYTPTFHFYRDGERVDEMFGAGEERLHDRLWLHS 128 >ref|XP_002326377.1| predicted protein [Populus trichocarpa] gi|566175931|ref|XP_006381396.1| hypothetical protein POPTR_0006s12500g [Populus trichocarpa] gi|550336099|gb|ERP59193.1| hypothetical protein POPTR_0006s12500g [Populus trichocarpa] Length = 127 Score = 114 bits (286), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPKLSFVYADIDECPETTQ IRYTPTF F+RDGE+VDEM GAGE+RLHDRLWLHS Sbjct: 70 SNNFPKLSFVYADIDECPETTQHIRYTPTFHFYRDGERVDEMFGAGEERLHDRLWLHS 127 >gb|EXB75879.1| Thioredoxin-like 3-3 [Morus notabilis] Length = 137 Score = 114 bits (285), Expect = 1e-23 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN+FPKLSF+YADIDECPETT IRYTPTFQF+RDGE+VDEM GAGE+RLHDRLWLHS Sbjct: 80 SNDFPKLSFIYADIDECPETTLHIRYTPTFQFYRDGERVDEMFGAGEERLHDRLWLHS 137 >gb|ESW34771.1| hypothetical protein PHAVU_001G179600g [Phaseolus vulgaris] Length = 128 Score = 114 bits (285), Expect = 1e-23 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPKL+FVYADIDECPETTQ IRYTPTFQF+R+GEKVDEM+G GE+RLHDRLWLHS Sbjct: 71 SNNFPKLTFVYADIDECPETTQHIRYTPTFQFYRNGEKVDEMYGTGEERLHDRLWLHS 128 >ref|XP_006448411.1| hypothetical protein CICLE_v10017163mg [Citrus clementina] gi|568828839|ref|XP_006468745.1| PREDICTED: thioredoxin-like 3-3-like isoform X1 [Citrus sinensis] gi|568828841|ref|XP_006468746.1| PREDICTED: thioredoxin-like 3-3-like isoform X2 [Citrus sinensis] gi|568828843|ref|XP_006468747.1| PREDICTED: thioredoxin-like 3-3-like isoform X3 [Citrus sinensis] gi|568828845|ref|XP_006468748.1| PREDICTED: thioredoxin-like 3-3-like isoform X4 [Citrus sinensis] gi|557551022|gb|ESR61651.1| hypothetical protein CICLE_v10017163mg [Citrus clementina] Length = 130 Score = 114 bits (285), Expect = 1e-23 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPKLSF+YADIDECPETTQ IRYTPTF F+RDGE+VDEM GAGE+RLHDRLWLHS Sbjct: 73 SNNFPKLSFIYADIDECPETTQHIRYTPTFHFYRDGERVDEMFGAGEERLHDRLWLHS 130 >ref|XP_002266281.2| PREDICTED: thioredoxin-like 3-3-like [Vitis vinifera] gi|297739963|emb|CBI30145.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 113 bits (283), Expect = 2e-23 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPKLSF+YADIDECPETTQ IRYTPTF F+RDGE+VDEM GAGE+RLHDRLWLHS Sbjct: 67 SNNFPKLSFIYADIDECPETTQHIRYTPTFHFYRDGERVDEMLGAGEERLHDRLWLHS 124 >gb|EMJ05214.1| hypothetical protein PRUPE_ppa020010mg [Prunus persica] Length = 139 Score = 112 bits (281), Expect = 4e-23 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPKLSF+YADIDECPETTQ IRYTPTF F+R+GE+VDEM GAGE+RLHDRLWLHS Sbjct: 82 SNSFPKLSFIYADIDECPETTQHIRYTPTFHFYREGERVDEMFGAGEERLHDRLWLHS 139 >ref|NP_566982.1| thioredoxin-like 3-3 [Arabidopsis thaliana] gi|75155215|sp|Q8LCH9.1|TRL33_ARATH RecName: Full=Thioredoxin-like 3-3 gi|21554669|gb|AAM63651.1| thioredoxin-like protein [Arabidopsis thaliana] gi|114050675|gb|ABI49487.1| At3g53220 [Arabidopsis thaliana] gi|332645528|gb|AEE79049.1| thioredoxin-like 3-3 [Arabidopsis thaliana] Length = 126 Score = 112 bits (281), Expect = 4e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN F KL FVYADIDECPETT+ IRYTPTFQF+RDGEKVDEM GAGEQRLHDRLWLHS Sbjct: 69 SNSFSKLKFVYADIDECPETTRHIRYTPTFQFYRDGEKVDEMFGAGEQRLHDRLWLHS 126 >ref|XP_004246620.1| PREDICTED: thioredoxin-like 3-3-like isoform 3 [Solanum lycopersicum] Length = 124 Score = 112 bits (279), Expect = 7e-23 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 S +FPKLSFVYADIDECPETTQ++RYTPTFQF+RDGE+VDEM G G++RLHDRLWLHS Sbjct: 67 SKKFPKLSFVYADIDECPETTQNLRYTPTFQFYRDGERVDEMFGGGDERLHDRLWLHS 124 >ref|XP_004246619.1| PREDICTED: thioredoxin-like 3-3-like isoform 2 [Solanum lycopersicum] Length = 133 Score = 112 bits (279), Expect = 7e-23 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 S +FPKLSFVYADIDECPETTQ++RYTPTFQF+RDGE+VDEM G G++RLHDRLWLHS Sbjct: 76 SKKFPKLSFVYADIDECPETTQNLRYTPTFQFYRDGERVDEMFGGGDERLHDRLWLHS 133 >ref|XP_004246618.1| PREDICTED: thioredoxin-like 3-3-like isoform 1 [Solanum lycopersicum] Length = 144 Score = 112 bits (279), Expect = 7e-23 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 S +FPKLSFVYADIDECPETTQ++RYTPTFQF+RDGE+VDEM G G++RLHDRLWLHS Sbjct: 87 SKKFPKLSFVYADIDECPETTQNLRYTPTFQFYRDGERVDEMFGGGDERLHDRLWLHS 144 >gb|EOY07937.1| Thioredoxin superfamily protein [Theobroma cacao] Length = 130 Score = 111 bits (277), Expect = 1e-22 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN+FPKLSF+YADIDECPETTQ IRYTPTF F+RDGE+VDEM GAGE+RL DRLWLHS Sbjct: 73 SNQFPKLSFIYADIDECPETTQHIRYTPTFLFYRDGERVDEMFGAGEERLQDRLWLHS 130 >ref|XP_004304468.1| PREDICTED: thioredoxin-like 3-3-like [Fragaria vesca subsp. vesca] Length = 131 Score = 111 bits (277), Expect = 1e-22 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 S+ FPK SFVYADIDECPETTQ IRYTPTF F+RDGE+VDEM GAGE+RLHDRLWLHS Sbjct: 74 SDSFPKFSFVYADIDECPETTQHIRYTPTFHFYRDGERVDEMFGAGEERLHDRLWLHS 131 >ref|XP_006354375.1| PREDICTED: thioredoxin-like 3-3-like [Solanum tuberosum] Length = 124 Score = 110 bits (276), Expect = 1e-22 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 S +FPKLSFVYADIDECPETTQ+IRYTPTF F+RDGE+VDEM G G++RLHDRLWLHS Sbjct: 67 SKKFPKLSFVYADIDECPETTQNIRYTPTFHFYRDGERVDEMFGGGDERLHDRLWLHS 124 >ref|XP_004143273.1| PREDICTED: thioredoxin-like 3-3-like [Cucumis sativus] gi|449482421|ref|XP_004156277.1| PREDICTED: thioredoxin-like 3-3-like [Cucumis sativus] Length = 127 Score = 110 bits (275), Expect = 2e-22 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 SN FPK+SF+YADIDECPETTQ IRYTPTF F+R GE+VDEM GAGE+RLHDRLWLHS Sbjct: 70 SNNFPKVSFIYADIDECPETTQHIRYTPTFHFYRGGERVDEMFGAGEERLHDRLWLHS 127 >ref|XP_002876194.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297322032|gb|EFH52453.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata] Length = 126 Score = 110 bits (275), Expect = 2e-22 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -2 Query: 445 SNEFPKLSFVYADIDECPETTQSIRYTPTFQFFRDGEKVDEMHGAGEQRLHDRLWLHS 272 S F KL FVYADIDECPETT+ IRYTPTFQF+RDGEKVDEM+GAGE+RLHDRLWLHS Sbjct: 69 SKNFSKLKFVYADIDECPETTRHIRYTPTFQFYRDGEKVDEMYGAGEERLHDRLWLHS 126