BLASTX nr result
ID: Stemona21_contig00009688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00009688 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531788.1| 50S ribosomal protein L19, putative [Ricinus... 60 3e-07 ref|XP_004147231.1| PREDICTED: 50S ribosomal protein L19, chloro... 59 5e-07 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloro... 59 5e-07 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 59 5e-07 gb|EXC02074.1| 50S ribosomal protein L19-1 [Morus notabilis] 58 1e-06 ref|XP_006477103.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 58 1e-06 gb|EOY24209.1| Ribosomal protein L19 family protein [Theobroma c... 58 1e-06 ref|XP_006440192.1| hypothetical protein CICLE_v10021998mg [Citr... 58 1e-06 ref|XP_006440191.1| hypothetical protein CICLE_v10021998mg [Citr... 58 1e-06 ref|XP_006440190.1| hypothetical protein CICLE_v10021998mg [Citr... 58 1e-06 ref|XP_004300339.1| PREDICTED: 50S ribosomal protein L19, chloro... 57 3e-06 ref|NP_001236421.1| uncharacterized protein LOC100500328 [Glycin... 56 6e-06 ref|XP_006572828.1| PREDICTED: uncharacterized protein LOC100500... 56 6e-06 ref|XP_006590250.1| PREDICTED: uncharacterized protein LOC100305... 55 7e-06 ref|NP_001238523.1| uncharacterized protein LOC100305649 [Glycin... 55 7e-06 >ref|XP_002531788.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223528581|gb|EEF30602.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 207 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKPIIKLGDIMGILN+RAVEA+E ER +PDIRT Sbjct: 109 RKPIIKLGDIMGILNRRAVEASENERPIPDIRT 141 >ref|XP_004147231.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] gi|449523724|ref|XP_004168873.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 221 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGD+MGILNKRA+EA+EKER +PDIRT Sbjct: 101 RKPRVKLGDVMGILNKRAIEASEKERPIPDIRT 133 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRA+EA+EKER VPD+RT Sbjct: 111 RKPRVKLGDIMGILNKRAIEASEKERPVPDLRT 143 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRA+EA+EKER VPD+RT Sbjct: 111 RKPRVKLGDIMGILNKRAIEASEKERPVPDLRT 143 >gb|EXC02074.1| 50S ribosomal protein L19-1 [Morus notabilis] Length = 265 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRAVEA+E ER +PDIRT Sbjct: 114 RKPRVKLGDIMGILNKRAVEASENERPIPDIRT 146 >ref|XP_006477103.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Citrus sinensis] Length = 236 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRAVEA+E ER +PDIRT Sbjct: 116 RKPRVKLGDIMGILNKRAVEASESERPIPDIRT 148 >gb|EOY24209.1| Ribosomal protein L19 family protein [Theobroma cacao] Length = 242 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP++KLGDIMGILNKRA+E +EK+R VPD+RT Sbjct: 122 RKPLVKLGDIMGILNKRAIEESEKQRPVPDLRT 154 >ref|XP_006440192.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] gi|557542454|gb|ESR53432.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] Length = 173 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRA+EA+E ER +PDIRT Sbjct: 116 RKPRVKLGDIMGILNKRAIEASESERPIPDIRT 148 >ref|XP_006440191.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] gi|557542453|gb|ESR53431.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] Length = 236 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRA+EA+E ER +PDIRT Sbjct: 116 RKPRVKLGDIMGILNKRAIEASESERPIPDIRT 148 >ref|XP_006440190.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] gi|557542452|gb|ESR53430.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] Length = 201 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILNKRA+EA+E ER +PDIRT Sbjct: 116 RKPRVKLGDIMGILNKRAIEASESERPIPDIRT 148 >ref|XP_004300339.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 233 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP IKLGD+MGILN RA++AAEKER VPDIR+ Sbjct: 113 RKPRIKLGDVMGILNSRAIDAAEKERPVPDIRS 145 >ref|NP_001236421.1| uncharacterized protein LOC100500328 [Glycine max] gi|255630036|gb|ACU15370.1| unknown [Glycine max] Length = 213 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILN+RA+EA+EK+R PDIRT Sbjct: 93 RKPRVKLGDIMGILNQRAIEASEKQRPTPDIRT 125 >ref|XP_006572828.1| PREDICTED: uncharacterized protein LOC100500328 isoform X1 [Glycine max] gi|255629017|gb|ACU14853.1| unknown [Glycine max] Length = 212 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGDIMGILN+RA+EA+EK+R PDIRT Sbjct: 92 RKPRVKLGDIMGILNQRAIEASEKQRPTPDIRT 124 >ref|XP_006590250.1| PREDICTED: uncharacterized protein LOC100305649 isoform X1 [Glycine max] Length = 212 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGD+MGILN+RA+EA+EK+R PDIRT Sbjct: 92 RKPRVKLGDVMGILNQRAIEASEKQRPTPDIRT 124 >ref|NP_001238523.1| uncharacterized protein LOC100305649 [Glycine max] gi|255626193|gb|ACU13441.1| unknown [Glycine max] Length = 213 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKPIIKLGDIMGILNKRAVEAAEKERQVPDIRT 3 RKP +KLGD+MGILN+RA+EA+EK+R PDIRT Sbjct: 93 RKPRVKLGDVMGILNQRAIEASEKQRPTPDIRT 125