BLASTX nr result
ID: Stemona21_contig00009586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00009586 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836171.1| hypothetical protein AMTR_s00101p00054450 [A... 100 3e-19 >ref|XP_006836171.1| hypothetical protein AMTR_s00101p00054450 [Amborella trichopoda] gi|548838671|gb|ERM99024.1| hypothetical protein AMTR_s00101p00054450 [Amborella trichopoda] Length = 179 Score = 100 bits (248), Expect = 3e-19 Identities = 44/90 (48%), Positives = 63/90 (70%) Frame = +2 Query: 224 PWDNVPWDWKTTAYVMMPYLMSIAFTGILRSTGLAGAPQLYSESTVSQLHNTDELAMKMF 403 PWD VPWDWK +VM+PY+MSI TGI+ S GL+ PQ + E + + + DE + F Sbjct: 87 PWD-VPWDWKVAVFVMLPYVMSILLTGIIESEGLSKIPQPHLEGLQAPMLSMDEQGNRFF 145 Query: 404 LDQAMKSLVKLSILYVFVSQHQPFPDDIFS 493 +DQ K++ KLS++YVF+S +QPF D++FS Sbjct: 146 IDQLFKTVAKLSVMYVFISPYQPFSDNLFS 175