BLASTX nr result
ID: Stemona21_contig00008766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00008766 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338750.1| PREDICTED: uncharacterized protein LOC102593... 57 3e-06 >ref|XP_006338750.1| PREDICTED: uncharacterized protein LOC102593285 [Solanum tuberosum] Length = 457 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 130 NLTVILLFNHIFPVYTAEQLTQKYTNFVFLLYCVTLVLVVAIN 2 N+ ++ NH PVYT EQL +KY+N FLLYC+TLVLVVA++ Sbjct: 122 NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLTLVLVVALH 164