BLASTX nr result
ID: Stemona21_contig00008757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00008757 (606 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002465957.1| hypothetical protein SORBIDRAFT_01g048850 [S... 57 3e-06 >ref|XP_002465957.1| hypothetical protein SORBIDRAFT_01g048850 [Sorghum bicolor] gi|241919811|gb|EER92955.1| hypothetical protein SORBIDRAFT_01g048850 [Sorghum bicolor] Length = 396 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +1 Query: 1 RIHEDGRIAKKALDLPIYAAYKDTPYLKISLQHMNTNS*SNGNINKR 141 RIHEDG+IA+KALDLPIYA YKD+PYL+ LQ + + S N + Sbjct: 350 RIHEDGKIAEKALDLPIYARYKDSPYLRNPLQQGSASDGSQAEQNSK 396