BLASTX nr result
ID: Stemona21_contig00008722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00008722 (353 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004973598.1| PREDICTED: subtilisin-like protease-like [Se... 57 3e-06 ref|XP_002444456.1| hypothetical protein SORBIDRAFT_07g022170 [S... 57 3e-06 gb|AFW61874.1| putative subtilase family protein [Zea mays] 56 6e-06 gb|ACN28448.1| unknown [Zea mays] 56 6e-06 >ref|XP_004973598.1| PREDICTED: subtilisin-like protease-like [Setaria italica] Length = 811 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 349 PGSSKVRSGELVWTDGRHRVRSPIVVTLQAPL 254 PGSS+VRSG L W+DGRH VRSPIVVT+QAPL Sbjct: 779 PGSSQVRSGALTWSDGRHVVRSPIVVTVQAPL 810 >ref|XP_002444456.1| hypothetical protein SORBIDRAFT_07g022170 [Sorghum bicolor] gi|241940806|gb|EES13951.1| hypothetical protein SORBIDRAFT_07g022170 [Sorghum bicolor] Length = 805 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 349 PGSSKVRSGELVWTDGRHRVRSPIVVTLQAPL 254 PGSS+VRSG L W+DGRH VRSPIVVT+QAPL Sbjct: 773 PGSSQVRSGALTWSDGRHVVRSPIVVTVQAPL 804 >gb|AFW61874.1| putative subtilase family protein [Zea mays] Length = 802 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 349 PGSSKVRSGELVWTDGRHRVRSPIVVTLQAPL 254 PGSS VRSG L W+DGRH VRSPIVVT+QAPL Sbjct: 770 PGSSLVRSGALTWSDGRHVVRSPIVVTVQAPL 801 >gb|ACN28448.1| unknown [Zea mays] Length = 35 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 349 PGSSKVRSGELVWTDGRHRVRSPIVVTLQAPL 254 PGSS VRSG L W+DGRH VRSPIVVT+QAPL Sbjct: 3 PGSSLVRSGALTWSDGRHVVRSPIVVTVQAPL 34