BLASTX nr result
ID: Stemona21_contig00008058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00008058 (585 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus commun... 160 2e-37 ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-lik... 159 4e-37 ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vit... 158 9e-37 ref|XP_002884335.1| thioredoxin F-type 1 [Arabidopsis lyrata sub... 157 1e-36 ref|XP_006408388.1| hypothetical protein EUTSA_v10021615mg [Eutr... 157 2e-36 ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|111354... 157 2e-36 ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycin... 157 2e-36 ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] gi|... 156 3e-36 ref|XP_004982992.1| PREDICTED: thioredoxin F, chloroplastic-like... 156 4e-36 gb|EOY09777.1| Thioredoxin F-type 1 [Theobroma cacao] 156 4e-36 gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus... 155 6e-36 ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, part... 155 7e-36 ref|XP_006286577.1| hypothetical protein CARUB_v10002058mg [Caps... 155 9e-36 sp|O48897.1|TRXF_BRANA RecName: Full=Thioredoxin F-type, chlorop... 155 9e-36 ref|XP_004492848.1| PREDICTED: thioredoxin F-type, chloroplastic... 154 1e-35 gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] 154 1e-35 ref|NP_001235872.1| uncharacterized protein LOC100499776 [Glycin... 154 2e-35 gb|EXC29957.1| Thioredoxin F-type [Morus notabilis] 153 4e-35 ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 153 4e-35 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 153 4e-35 >ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Length = 186 Score = 160 bits (405), Expect = 2e-37 Identities = 77/90 (85%), Positives = 82/90 (91%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSL+T RA VGQVTEVSKDTFWPIVK AG K VVLDMYTQWCGPCK+MAPKF+ LSEK Sbjct: 67 SSLDTVGPRATVGQVTEVSKDTFWPIVKSAGDKTVVLDMYTQWCGPCKIMAPKFQQLSEK 126 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 YLDVVFLKLDCNQDN+PLAKELGI+VVPTF Sbjct: 127 YLDVVFLKLDCNQDNKPLAKELGIRVVPTF 156 >ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] gi|449476195|ref|XP_004154668.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] Length = 180 Score = 159 bits (403), Expect = 4e-37 Identities = 77/88 (87%), Positives = 80/88 (90%) Frame = +2 Query: 320 SSLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYL 499 SSLETA A VGQVTEV+KDTFWPIV AG K VVLDMYTQWCGPCKVMAPKF+ LSEKYL Sbjct: 63 SSLETAGATVGQVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVMAPKFQDLSEKYL 122 Query: 500 DVVFLKLDCNQDNRPLAKELGIKVVPTF 583 DVVFLKLDCN DN+PLAKELGIKVVPTF Sbjct: 123 DVVFLKLDCNIDNKPLAKELGIKVVPTF 150 >ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vitis vinifera] gi|297735248|emb|CBI17610.3| unnamed protein product [Vitis vinifera] Length = 172 Score = 158 bits (400), Expect = 9e-37 Identities = 75/88 (85%), Positives = 81/88 (92%) Frame = +2 Query: 320 SSLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYL 499 SS++TA AVVGQVTEV+KDTFWPIVK AG K VVLDMYTQWCGPCKVMAPKF+ LS KYL Sbjct: 55 SSIDTAEAVVGQVTEVNKDTFWPIVKAAGDKAVVLDMYTQWCGPCKVMAPKFQELSGKYL 114 Query: 500 DVVFLKLDCNQDNRPLAKELGIKVVPTF 583 DVVFLKLDCNQDN+ LAKELGI+VVPTF Sbjct: 115 DVVFLKLDCNQDNKTLAKELGIRVVPTF 142 >ref|XP_002884335.1| thioredoxin F-type 1 [Arabidopsis lyrata subsp. lyrata] gi|297330175|gb|EFH60594.1| thioredoxin F-type 1 [Arabidopsis lyrata subsp. lyrata] Length = 178 Score = 157 bits (398), Expect = 1e-36 Identities = 75/87 (86%), Positives = 78/87 (89%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIVK AG KIVVLDMYTQWCGPCKV+APK+KALSEKY D Sbjct: 59 SLETVNVSVGQVTEVDKDTFWPIVKAAGEKIVVLDMYTQWCGPCKVIAPKYKALSEKYED 118 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 VVFLKLDCN DNRPLAKELGI+VVPTF Sbjct: 119 VVFLKLDCNPDNRPLAKELGIRVVPTF 145 >ref|XP_006408388.1| hypothetical protein EUTSA_v10021615mg [Eutrema salsugineum] gi|557109534|gb|ESQ49841.1| hypothetical protein EUTSA_v10021615mg [Eutrema salsugineum] Length = 181 Score = 157 bits (396), Expect = 2e-36 Identities = 75/87 (86%), Positives = 78/87 (89%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIVK AG KIVVLDMYTQWCGPCKV+APK+KALSEKY D Sbjct: 62 SLETVSVNVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKALSEKYED 121 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 VVFLKLDCN DNRPLAKELGI+VVPTF Sbjct: 122 VVFLKLDCNPDNRPLAKELGIRVVPTF 148 >ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|11135405|sp|Q9XFH9.1|TRXF2_ARATH RecName: Full=Thioredoxin F2, chloroplastic; Short=AtTrxf2; AltName: Full=Thioredoxin F1; Short=AtTrxf1; Flags: Precursor gi|4973254|gb|AAD35004.1|AF144386_1 thioredoxin f2 [Arabidopsis thaliana] gi|13878187|gb|AAK44171.1|AF370356_1 putative thioredoxin f2 protein [Arabidopsis thaliana] gi|9759122|dbj|BAB09607.1| thioredoxin f2 [Arabidopsis thaliana] gi|16323396|gb|AAL15192.1| putative thioredoxin f2 protein [Arabidopsis thaliana] gi|332004905|gb|AED92288.1| thioredoxin F2 [Arabidopsis thaliana] Length = 185 Score = 157 bits (396), Expect = 2e-36 Identities = 73/87 (83%), Positives = 78/87 (89%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIVK AG KIVVLDMYTQWCGPCKV+APK+K LSEKY D Sbjct: 69 SLETVNVTVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQD 128 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 +VFLKLDCNQDN+PLAKELGI+VVPTF Sbjct: 129 MVFLKLDCNQDNKPLAKELGIRVVPTF 155 >ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycine max] gi|255628867|gb|ACU14778.1| unknown [Glycine max] Length = 179 Score = 157 bits (396), Expect = 2e-36 Identities = 78/90 (86%), Positives = 80/90 (88%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSLETA VGQVTEV+KDTFWPIVK AG K VVLDMYTQWCGPCKVMAPKF+ LSEK Sbjct: 60 SSLETAGPTVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQELSEK 119 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 YLDVVFLKLDCNQDNRPLA ELGIKVVPTF Sbjct: 120 YLDVVFLKLDCNQDNRPLAIELGIKVVPTF 149 >ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] gi|27735269|sp|Q9XFH8.2|TRXF1_ARATH RecName: Full=Thioredoxin F1, chloroplastic; Short=AtTrxf1; AltName: Full=Thioredoxin F2; Short=AtTrxf2; Flags: Precursor gi|6728989|gb|AAF26987.1|AC018363_32 thioredoxin f1 [Arabidopsis thaliana] gi|17529210|gb|AAL38832.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|20466041|gb|AAM20355.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|21537004|gb|AAM61345.1| thioredoxin f1 [Arabidopsis thaliana] gi|332640331|gb|AEE73852.1| thioredoxin F-type 1 [Arabidopsis thaliana] Length = 178 Score = 156 bits (395), Expect = 3e-36 Identities = 74/87 (85%), Positives = 78/87 (89%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIVK AG K+VVLDMYTQWCGPCKV+APK+KALSEKY D Sbjct: 59 SLETVNVSVGQVTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDD 118 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 VVFLKLDCN DNRPLAKELGI+VVPTF Sbjct: 119 VVFLKLDCNPDNRPLAKELGIRVVPTF 145 >ref|XP_004982992.1| PREDICTED: thioredoxin F, chloroplastic-like [Setaria italica] Length = 181 Score = 156 bits (394), Expect = 4e-36 Identities = 76/92 (82%), Positives = 82/92 (89%), Gaps = 4/92 (4%) Frame = +2 Query: 320 SSLET----ARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALS 487 SSLET A AV GQVTEV+KDTFWPIVK AG K+VVLDMYTQWCGPCK+MAPKF+ +S Sbjct: 62 SSLETTSVGAEAVTGQVTEVTKDTFWPIVKAAGDKVVVLDMYTQWCGPCKMMAPKFQEMS 121 Query: 488 EKYLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 EK LDVVFLKLDCNQDN+PLAKELGIKVVPTF Sbjct: 122 EKNLDVVFLKLDCNQDNKPLAKELGIKVVPTF 153 >gb|EOY09777.1| Thioredoxin F-type 1 [Theobroma cacao] Length = 189 Score = 156 bits (394), Expect = 4e-36 Identities = 74/88 (84%), Positives = 80/88 (90%) Frame = +2 Query: 320 SSLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYL 499 SSL+TA A VGQV EV+KDTFWPIV AG K VVLDMYTQWCGPCKV+APKF+ LSEKYL Sbjct: 72 SSLDTAGAKVGQVKEVTKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKFQELSEKYL 131 Query: 500 DVVFLKLDCNQDNRPLAKELGIKVVPTF 583 DVVFLKLDCNQDN+PLAKELGI+VVPTF Sbjct: 132 DVVFLKLDCNQDNKPLAKELGIRVVPTF 159 >gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] Length = 181 Score = 155 bits (393), Expect = 6e-36 Identities = 77/90 (85%), Positives = 80/90 (88%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSLETA VGQVTEV+KDTFWPIVK AG K VVLDMYTQWCGPCKVMAPKF+ LS+K Sbjct: 62 SSLETAGPTVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQELSKK 121 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 Y DVVFLKLDCNQDNRPLAKELGIKVVPTF Sbjct: 122 YEDVVFLKLDCNQDNRPLAKELGIKVVPTF 151 >ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] gi|482567257|gb|EOA31446.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] Length = 209 Score = 155 bits (392), Expect = 7e-36 Identities = 74/87 (85%), Positives = 77/87 (88%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIV AG KIVVLDMYTQWCGPCKV+APK+KALSEKY D Sbjct: 89 SLETVNVSVGQVTEVDKDTFWPIVNAAGEKIVVLDMYTQWCGPCKVIAPKYKALSEKYDD 148 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 VVFLKLDCN DNRPLAKELGI+VVPTF Sbjct: 149 VVFLKLDCNPDNRPLAKELGIRVVPTF 175 >ref|XP_006286577.1| hypothetical protein CARUB_v10002058mg [Capsella rubella] gi|482555283|gb|EOA19475.1| hypothetical protein CARUB_v10002058mg [Capsella rubella] Length = 185 Score = 155 bits (391), Expect = 9e-36 Identities = 73/87 (83%), Positives = 77/87 (88%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIVK AG KIVVLDMYTQWCGPCKV+APK+K LSEKY D Sbjct: 69 SLETVNVSVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQD 128 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 +VFLKLDC QDN+PLAKELGIKVVPTF Sbjct: 129 MVFLKLDCTQDNKPLAKELGIKVVPTF 155 >sp|O48897.1|TRXF_BRANA RecName: Full=Thioredoxin F-type, chloroplastic; Short=Trx-F; Flags: Precursor gi|2921094|gb|AAC04671.1| thioredoxin-f [Brassica napus] Length = 182 Score = 155 bits (391), Expect = 9e-36 Identities = 73/87 (83%), Positives = 78/87 (89%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SL+T VGQVTEV KDTFWPIVK AG KIVVLDMYTQWCGPCKV+APK+KALSEKY D Sbjct: 62 SLQTVNVSVGQVTEVDKDTFWPIVKAAGEKIVVLDMYTQWCGPCKVIAPKYKALSEKYED 121 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 VVFLKLDCN +NRPLAKELGI+VVPTF Sbjct: 122 VVFLKLDCNPENRPLAKELGIRVVPTF 148 >ref|XP_004492848.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Cicer arietinum] Length = 181 Score = 154 bits (390), Expect = 1e-35 Identities = 75/90 (83%), Positives = 80/90 (88%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSLETA VGQVTEV+KDTFWPIV AG K VVLDM+TQWCGPCKV+APKFK LSEK Sbjct: 62 SSLETAGPTVTVGQVTEVNKDTFWPIVNAAGDKTVVLDMFTQWCGPCKVIAPKFKELSEK 121 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 YLDVVFLKLDCNQDN+PLAKELG+KVVPTF Sbjct: 122 YLDVVFLKLDCNQDNKPLAKELGLKVVPTF 151 >gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] Length = 178 Score = 154 bits (390), Expect = 1e-35 Identities = 73/87 (83%), Positives = 77/87 (88%) Frame = +2 Query: 323 SLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYLD 502 SLET VGQVTEV KDTFWPIVK AG K+VVLDMYTQWCGPCKV+APK+KALSEKY D Sbjct: 59 SLETVNVSVGQVTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDD 118 Query: 503 VVFLKLDCNQDNRPLAKELGIKVVPTF 583 VVFLKLDCN DNRPL KELGI+VVPTF Sbjct: 119 VVFLKLDCNPDNRPLPKELGIRVVPTF 145 >ref|NP_001235872.1| uncharacterized protein LOC100499776 [Glycine max] gi|255626459|gb|ACU13574.1| unknown [Glycine max] Length = 181 Score = 154 bits (389), Expect = 2e-35 Identities = 76/90 (84%), Positives = 79/90 (87%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSLETA VGQVTEV+KDTFWPIVK AG K VVLDMYTQWCGPCKVMAPKF+ LSEK Sbjct: 62 SSLETAGPTVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQELSEK 121 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 YLDVVFLK DCNQ+NRPLAKELGIK VPTF Sbjct: 122 YLDVVFLKHDCNQENRPLAKELGIKAVPTF 151 >gb|EXC29957.1| Thioredoxin F-type [Morus notabilis] Length = 184 Score = 153 bits (386), Expect = 4e-35 Identities = 72/88 (81%), Positives = 79/88 (89%) Frame = +2 Query: 320 SSLETARAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEKYL 499 SSLET R VG+VTEV+KD+FWPIV AG K VVLDMYTQWCGPCKV+APKF+ LSEKYL Sbjct: 67 SSLETLRPTVGKVTEVNKDSFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKFQELSEKYL 126 Query: 500 DVVFLKLDCNQDNRPLAKELGIKVVPTF 583 DVVFLKLDCNQDN+ LAKELGI+VVPTF Sbjct: 127 DVVFLKLDCNQDNKALAKELGIRVVPTF 154 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 153 bits (386), Expect = 4e-35 Identities = 74/90 (82%), Positives = 79/90 (87%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSLET VGQVTEV+KDTFWPIV AG K VVLDMYTQWCGPCKV+APK+K L+EK Sbjct: 63 SSLETTGPTVTVGQVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKYKELAEK 122 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 YLDVVFLKLDCNQDN+PLAKELGIKVVPTF Sbjct: 123 YLDVVFLKLDCNQDNKPLAKELGIKVVPTF 152 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 153 bits (386), Expect = 4e-35 Identities = 74/90 (82%), Positives = 79/90 (87%), Gaps = 2/90 (2%) Frame = +2 Query: 320 SSLETA--RAVVGQVTEVSKDTFWPIVKDAGSKIVVLDMYTQWCGPCKVMAPKFKALSEK 493 SSLET VGQVTEV+KDTFWPIV AG K VVLDMYTQWCGPCKV+APK+K L+EK Sbjct: 67 SSLETTGPTVTVGQVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKYKELAEK 126 Query: 494 YLDVVFLKLDCNQDNRPLAKELGIKVVPTF 583 YLDVVFLKLDCNQDN+PLAKELGIKVVPTF Sbjct: 127 YLDVVFLKLDCNQDNKPLAKELGIKVVPTF 156