BLASTX nr result
ID: Stemona21_contig00008054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00008054 (455 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY04133.1| Alpha/beta-Hydrolases superfamily protein isoform... 78 1e-12 gb|EOY04132.1| Alpha/beta-Hydrolases superfamily protein isoform... 78 1e-12 ref|XP_004167015.1| PREDICTED: abhydrolase domain-containing pro... 75 9e-12 ref|XP_004150516.1| PREDICTED: abhydrolase domain-containing pro... 75 9e-12 ref|XP_006383416.1| hypothetical protein POPTR_0005s15290g [Popu... 75 1e-11 ref|XP_002329344.1| predicted protein [Populus trichocarpa] 75 1e-11 gb|EXC20512.1| hypothetical protein L484_027065 [Morus notabilis] 73 3e-11 ref|XP_006357838.1| PREDICTED: alpha/beta hydrolase domain-conta... 70 2e-10 gb|EMJ16812.1| hypothetical protein PRUPE_ppa007848mg [Prunus pe... 70 2e-10 ref|XP_002516760.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_004232340.1| PREDICTED: abhydrolase domain-containing pro... 70 3e-10 ref|XP_006430733.1| hypothetical protein CICLE_v10012120mg [Citr... 69 5e-10 ref|XP_006358060.1| PREDICTED: alpha/beta hydrolase domain-conta... 69 7e-10 ref|XP_006603984.1| PREDICTED: alpha/beta hydrolase domain-conta... 69 9e-10 ref|XP_003553261.1| PREDICTED: alpha/beta hydrolase domain-conta... 69 9e-10 emb|CBI33630.3| unnamed protein product [Vitis vinifera] 69 9e-10 ref|XP_002284149.1| PREDICTED: abhydrolase domain-containing pro... 69 9e-10 ref|XP_006482219.1| PREDICTED: alpha/beta hydrolase domain-conta... 67 2e-09 ref|XP_006482211.1| PREDICTED: alpha/beta hydrolase domain-conta... 67 2e-09 ref|XP_006476222.1| PREDICTED: uncharacterized protein LOC102613... 67 2e-09 >gb|EOY04133.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 232 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/65 (60%), Positives = 48/65 (73%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 N D+ ++ EI S E SD E+SR SLDSR+ K KKS+KPEKSRMSTDRVDR +R+ Sbjct: 168 NSDNQSKPSEIGTSDTFELGSDLPEVSRNSLDSRLEKSKKSNKPEKSRMSTDRVDRFRRK 227 Query: 184 RGLVW 198 +GLVW Sbjct: 228 KGLVW 232 >gb|EOY04132.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 342 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/65 (60%), Positives = 48/65 (73%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 N D+ ++ EI S E SD E+SR SLDSR+ K KKS+KPEKSRMSTDRVDR +R+ Sbjct: 278 NSDNQSKPSEIGTSDTFELGSDLPEVSRNSLDSRLEKSKKSNKPEKSRMSTDRVDRFRRK 337 Query: 184 RGLVW 198 +GLVW Sbjct: 338 KGLVW 342 >ref|XP_004167015.1| PREDICTED: abhydrolase domain-containing protein FAM108B1-like [Cucumis sativus] Length = 342 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/63 (57%), Positives = 46/63 (73%) Frame = +1 Query: 10 DDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRG 189 D+ + E PS E +D E+SR SLDSR+ K KK++KPEKSRMSTDRVDR ++R+G Sbjct: 280 DNQNKPSETGPSDTFELAADLPEVSRNSLDSRLEKSKKANKPEKSRMSTDRVDRFRKRKG 339 Query: 190 LVW 198 LVW Sbjct: 340 LVW 342 >ref|XP_004150516.1| PREDICTED: abhydrolase domain-containing protein FAM108C1-like [Cucumis sativus] Length = 299 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/63 (57%), Positives = 46/63 (73%) Frame = +1 Query: 10 DDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRG 189 D+ + E PS E +D E+SR SLDSR+ K KK++KPEKSRMSTDRVDR ++R+G Sbjct: 237 DNQNKPSETGPSDTFELAADLPEVSRNSLDSRLEKSKKANKPEKSRMSTDRVDRFRKRKG 296 Query: 190 LVW 198 LVW Sbjct: 297 LVW 299 >ref|XP_006383416.1| hypothetical protein POPTR_0005s15290g [Populus trichocarpa] gi|550339026|gb|ERP61213.1| hypothetical protein POPTR_0005s15290g [Populus trichocarpa] Length = 347 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/64 (59%), Positives = 45/64 (70%) Frame = +1 Query: 7 EDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRR 186 E +N + S D E+ D EISR SLDSR+ K KK +KPEKSRMSTDRVDR +RR+ Sbjct: 284 ESENQNKPSESASSDTFELGDLPEISRNSLDSRLEKSKKPNKPEKSRMSTDRVDRFRRRK 343 Query: 187 GLVW 198 GLVW Sbjct: 344 GLVW 347 >ref|XP_002329344.1| predicted protein [Populus trichocarpa] Length = 131 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/64 (59%), Positives = 45/64 (70%) Frame = +1 Query: 7 EDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRR 186 E +N + S D E+ D EISR SLDSR+ K KK +KPEKSRMSTDRVDR +RR+ Sbjct: 68 ESENQNKPSESASSDTFELGDLPEISRNSLDSRLEKSKKPNKPEKSRMSTDRVDRFRRRK 127 Query: 187 GLVW 198 GLVW Sbjct: 128 GLVW 131 >gb|EXC20512.1| hypothetical protein L484_027065 [Morus notabilis] Length = 342 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/63 (60%), Positives = 44/63 (69%) Frame = +1 Query: 10 DDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRG 189 D T+ E S E +D EISR SLDSR+ K KK +KPEKSRMSTDRVDR +RR+G Sbjct: 280 DGQTKPAEAGTSDTFELGADLPEISRNSLDSRLEKSKKPNKPEKSRMSTDRVDRFRRRKG 339 Query: 190 LVW 198 LVW Sbjct: 340 LVW 342 >ref|XP_006357838.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Solanum tuberosum] Length = 339 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/64 (59%), Positives = 44/64 (68%) Frame = +1 Query: 7 EDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRR 186 E T ++KP D EISR SLDSR+ K KKS+KPEKSRMSTDRVDR +RR+ Sbjct: 284 ESGATDTFDLKP--------DLPEISRNSLDSRLEKTKKSNKPEKSRMSTDRVDRFRRRK 335 Query: 187 GLVW 198 GLVW Sbjct: 336 GLVW 339 >gb|EMJ16812.1| hypothetical protein PRUPE_ppa007848mg [Prunus persica] Length = 353 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/64 (57%), Positives = 43/64 (67%) Frame = +1 Query: 7 EDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRR 186 + D + E S E SD E+SR SLDSR+ K KK +KPEKSRMSTDRVD KRR+ Sbjct: 290 DSDECKPPETGTSDSSELGSDLPEVSRNSLDSRLEKSKKPNKPEKSRMSTDRVDTFKRRK 349 Query: 187 GLVW 198 GLVW Sbjct: 350 GLVW 353 >ref|XP_002516760.1| conserved hypothetical protein [Ricinus communis] gi|223544133|gb|EEF45658.1| conserved hypothetical protein [Ricinus communis] Length = 143 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +1 Query: 7 EDDNTRQIEIKPSHDLEEVS-DYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 E +N +I + D E+ D EISR SLDSR+ K KK +KPEKSRMSTDRVDR +RR Sbjct: 79 EAENQNKISESGTSDTFELGGDLPEISRNSLDSRLEKSKKPNKPEKSRMSTDRVDRFRRR 138 Query: 184 RGLVW 198 +GLVW Sbjct: 139 KGLVW 143 >ref|XP_004232340.1| PREDICTED: abhydrolase domain-containing protein FAM108B1-like [Solanum lycopersicum] Length = 340 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +1 Query: 67 DYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRGLVW 198 D EISR SLDSR+ K KKS+KPEKSRMSTDRVDR +RR+GLVW Sbjct: 297 DLPEISRNSLDSRLEKTKKSNKPEKSRMSTDRVDRFRRRKGLVW 340 >ref|XP_006430733.1| hypothetical protein CICLE_v10012120mg [Citrus clementina] gi|557532790|gb|ESR43973.1| hypothetical protein CICLE_v10012120mg [Citrus clementina] Length = 342 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/65 (52%), Positives = 46/65 (70%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 + D+ ++ + PS E +D E+SR SLDSR+ K KKS+KPEKSRMSTD VDR +R+ Sbjct: 278 DSDNQSKTSDSGPSDTFELGADLPEVSRNSLDSRLEKSKKSNKPEKSRMSTDHVDRFRRK 337 Query: 184 RGLVW 198 + LVW Sbjct: 338 KRLVW 342 >ref|XP_006358060.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Solanum tuberosum] Length = 341 Score = 68.9 bits (167), Expect = 7e-10 Identities = 37/62 (59%), Positives = 43/62 (69%) Frame = +1 Query: 13 DNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRGL 192 D + E S+ L SD EISR SLDSR+ K KKS+KPEKSRMST VDR +RR+GL Sbjct: 280 DTKKPAESVSSNTLNLHSDLPEISRNSLDSRLDKAKKSNKPEKSRMSTGCVDRFRRRKGL 339 Query: 193 VW 198 VW Sbjct: 340 VW 341 >ref|XP_006603984.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X2 [Glycine max] Length = 323 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/65 (53%), Positives = 45/65 (69%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 N+ +++ E S E ++ E+SR SLDSR+ K KK DKPEKSRMSTD VDR +RR Sbjct: 259 NQGKASKESESGTSVTSELSTEIPEVSRNSLDSRLEKSKKPDKPEKSRMSTDHVDRFRRR 318 Query: 184 RGLVW 198 +GLVW Sbjct: 319 KGLVW 323 >ref|XP_003553261.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X1 [Glycine max] Length = 354 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/65 (53%), Positives = 45/65 (69%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 N+ +++ E S E ++ E+SR SLDSR+ K KK DKPEKSRMSTD VDR +RR Sbjct: 290 NQGKASKESESGTSVTSELSTEIPEVSRNSLDSRLEKSKKPDKPEKSRMSTDHVDRFRRR 349 Query: 184 RGLVW 198 +GLVW Sbjct: 350 KGLVW 354 >emb|CBI33630.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/65 (53%), Positives = 44/65 (67%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 + D ++ E S E +D E SR SLDSR+ K KK++KPEKSRMSTD VDR +RR Sbjct: 194 DSDSQSKTSESGTSDAFELSTDLPEASRNSLDSRLEKSKKTNKPEKSRMSTDHVDRFRRR 253 Query: 184 RGLVW 198 +GLVW Sbjct: 254 KGLVW 258 >ref|XP_002284149.1| PREDICTED: abhydrolase domain-containing protein FAM108B1 [Vitis vinifera] gi|147856513|emb|CAN82502.1| hypothetical protein VITISV_029334 [Vitis vinifera] Length = 342 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/65 (53%), Positives = 44/65 (67%) Frame = +1 Query: 4 NEDDNTRQIEIKPSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRR 183 + D ++ E S E +D E SR SLDSR+ K KK++KPEKSRMSTD VDR +RR Sbjct: 278 DSDSQSKTSESGTSDAFELSTDLPEASRNSLDSRLEKSKKTNKPEKSRMSTDHVDRFRRR 337 Query: 184 RGLVW 198 +GLVW Sbjct: 338 KGLVW 342 >ref|XP_006482219.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X1 [Citrus sinensis] Length = 342 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +1 Query: 40 PSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRGLVW 198 PS E +D E+SR SLDSR+ K KKS+KPEKSRMSTD VDR +R++ LVW Sbjct: 290 PSDTFELGADLPEVSRNSLDSRLEKSKKSNKPEKSRMSTDHVDRFRRKKRLVW 342 >ref|XP_006482211.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Citrus sinensis] gi|568857331|ref|XP_006482220.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X2 [Citrus sinensis] gi|568860084|ref|XP_006483557.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Citrus sinensis] Length = 267 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +1 Query: 40 PSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRGLVW 198 PS E +D E+SR SLDSR+ K KKS+KPEKSRMSTD VDR +R++ LVW Sbjct: 215 PSDTFELGADLPEVSRNSLDSRLEKSKKSNKPEKSRMSTDHVDRFRRKKRLVW 267 >ref|XP_006476222.1| PREDICTED: uncharacterized protein LOC102613073 [Citrus sinensis] Length = 558 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +1 Query: 40 PSHDLEEVSDYHEISRKSLDSRIGKPKKSDKPEKSRMSTDRVDRGKRRRGLVW 198 PS E +D E+SR SLDSR+ K KKS+KPEKSRMSTD VDR +R++ LVW Sbjct: 506 PSDTFELGADLPEVSRNSLDSRLEKSKKSNKPEKSRMSTDHVDRFRRKKRLVW 558