BLASTX nr result
ID: Stemona21_contig00003271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00003271 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Mor... 91 2e-16 gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus pe... 89 9e-16 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 87 4e-15 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 86 6e-15 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 86 6e-15 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 86 6e-15 ref|XP_006473187.1| PREDICTED: mitochondrial import receptor sub... 86 8e-15 ref|XP_002458448.1| hypothetical protein SORBIDRAFT_03g033695 [S... 86 8e-15 ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citr... 86 1e-14 ref|XP_004242882.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 85 1e-14 ref|XP_002308124.1| Mitochondrial import receptor subunit TOM7 f... 85 1e-14 ref|XP_002335848.1| predicted protein [Populus trichocarpa] gi|5... 85 1e-14 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 85 2e-14 ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 85 2e-14 ref|XP_004969849.1| PREDICTED: mitochondrial import receptor sub... 84 2e-14 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 84 2e-14 ref|XP_006360661.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 84 3e-14 gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] 84 3e-14 >gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Morus notabilis] Length = 71 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 ST + KEW+TWA KKAKVITHYGFIPLVIIIGMNS+PKPH+SQLLSPV Sbjct: 23 STAQLVKEWTTWAAKKAKVITHYGFIPLVIIIGMNSDPKPHLSQLLSPV 71 >gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 89.0 bits (219), Expect = 9e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 S + KEWSTWAMKKAKV+THYGFIPL+I+IGMNSEPKP +SQLLSPV Sbjct: 25 SVAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 86.7 bits (213), Expect = 4e-15 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 +TVR KEW+TW MKKAKV+ HYGFIPLVI+IGMNSEPKP + QLLSPV Sbjct: 31 TTVRLVKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 86.3 bits (212), Expect = 6e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 S + KEW+TWA+KKAKV+THYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 25 SATQAFKEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 ST++ KEWSTW +KKAKVITHYGFIPLV+IIGMNSEPKP + QLL+PV Sbjct: 27 STIQCLKEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 +TVR KEW+TW MKKAKV+ HYGFIPLVI+IGMNSEPKP + QLLSPV Sbjct: 31 TTVRLMKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_006473187.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 71 Score = 85.9 bits (211), Expect = 8e-15 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 127 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 KEWSTWAMKKAKVITHYGFIPLVIIIGMNS+PKP + QLLSPV Sbjct: 29 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71 >ref|XP_002458448.1| hypothetical protein SORBIDRAFT_03g033695 [Sorghum bicolor] gi|241930423|gb|EES03568.1| hypothetical protein SORBIDRAFT_03g033695 [Sorghum bicolor] Length = 69 Score = 85.9 bits (211), Expect = 8e-15 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 S R A+EWSTWAMKKAKV HYGFIPLVI+IGMNSEPKP ++QLLSP+ Sbjct: 21 SAARRAREWSTWAMKKAKVAAHYGFIPLVILIGMNSEPKPRLAQLLSPI 69 >ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|567884091|ref|XP_006434604.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536725|gb|ESR47843.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536726|gb|ESR47844.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 127 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 KEWSTWAMKKAKVITHYGFIPLVIIIGMNS+PKP + QLLSPV Sbjct: 29 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQLLSPV 71 >ref|XP_004242882.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 77 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 118 RYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 ++ KEW TW+ KKAKVITHYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 32 KFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 85.1 bits (209), Expect = 1e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 118 RYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 ++ KEW TW KKAKVITHYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 27 KFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >ref|XP_002308124.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|222854100|gb|EEE91647.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 85.1 bits (209), Expect = 1e-14 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSP 252 S +Y KEWSTW+ KKAKVITHYGFIP++IIIGMNSEPKP I QLLSP Sbjct: 26 SASQYFKEWSTWSFKKAKVITHYGFIPMIIIIGMNSEPKPQIHQLLSP 73 >ref|XP_002335848.1| predicted protein [Populus trichocarpa] gi|566215807|ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|550318729|gb|ERP49995.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 85.1 bits (209), Expect = 1e-14 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSP 252 S +Y KEWSTW KKAKVITHYGFIP++IIIGMNSEPKP I QLLSP Sbjct: 26 SASQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMNSEPKPQIYQLLSP 73 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 127 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 KEW+TWAM+KAKVITHYGFIPLVIIIGMNS+PKP +SQLLSPV Sbjct: 30 KEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Vitis vinifera] Length = 73 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 ST + K+WS WA+KKAKVITHYGFIP+VIIIGMNSEPKP + QLLSPV Sbjct: 25 STAKCLKDWSNWALKKAKVITHYGFIPMVIIIGMNSEPKPQLYQLLSPV 73 >ref|XP_004969849.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Setaria italica] Length = 70 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 S R A+EW+TWAMKKAKV+ HYGFIP VI++GMNSEPKP ++QLLSP+ Sbjct: 22 SAARRAREWTTWAMKKAKVVAHYGFIPFVILVGMNSEPKPRLTQLLSPI 70 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 127 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 KEW+TWAM+KAKVITHYGFIPLVI+IGMNS+PKP +SQLLSPV Sbjct: 30 KEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_006360661.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 84.0 bits (206), Expect = 3e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 121 YAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 + K+WSTW KKAKVITHYGFIPLVII+GMNSEPKP +SQLLSPV Sbjct: 34 FVKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 84.0 bits (206), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 S V KEWSTW MKKAKV+THYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 24 SMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 84.0 bits (206), Expect = 3e-14 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +1 Query: 109 STVRYAKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHISQLLSPV 255 + + K+WS W +KKAKVITHYGFIPL+IIIGMNSEPKP ISQLLSPV Sbjct: 33 AATKLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPKPSISQLLSPV 81