BLASTX nr result
ID: Stemona21_contig00001539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00001539 (435 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004978077.1| PREDICTED: polygalacturonase inhibitor-like ... 75 9e-12 ref|XP_002448030.1| hypothetical protein SORBIDRAFT_06g019870 [S... 74 2e-11 gb|ACB30360.1| PGIP [Capsicum annuum] 74 2e-11 gb|AFN53656.1| putative serine-threonine protein kinase [Linum u... 74 3e-11 gb|ADV16115.1| polygalacturonase inhibitor protein, partial [Car... 74 3e-11 gb|AAT77777.1| polygalacturonase inhibitor protein [Carica papaya] 74 3e-11 ref|XP_006850091.1| hypothetical protein AMTR_s00022p00220000 [A... 73 3e-11 gb|ABA29012.1| polygalacturonase inhibitor [Solanum palustre] 73 3e-11 ref|XP_004973874.1| PREDICTED: polygalacturonase inhibitor 1-lik... 72 6e-11 gb|AFW75085.1| hypothetical protein ZEAMMB73_943639 [Zea mays] 72 6e-11 gb|ABO26221.1| polygalacturonase inhibiting protein [Prunus pers... 72 6e-11 emb|CAF04489.1| putative polygalacturonase-inhibiting protein [s... 72 8e-11 ref|XP_006346175.1| PREDICTED: polygalacturonase inhibitor-like ... 72 1e-10 gb|ABA29013.1| polygalacturonase inhibitor [Solanum palustre] 72 1e-10 gb|AAT77428.2| polygalacturonase inhibitor protein precursor [So... 72 1e-10 tpg|DAA37343.1| TPA: hypothetical protein ZEAMMB73_259111 [Zea m... 72 1e-10 dbj|BAK00896.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 1e-10 gb|ACU20006.1| unknown [Glycine max] 72 1e-10 ref|XP_002439097.1| hypothetical protein SORBIDRAFT_09g000430 [S... 72 1e-10 ref|XP_003531065.1| PREDICTED: polygalacturonase inhibitor 2 [Gl... 72 1e-10 >ref|XP_004978077.1| PREDICTED: polygalacturonase inhibitor-like [Setaria italica] Length = 333 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 ++SYNQLCGEIPTGG M QF A++Y HNKCLCGTPLPPC Sbjct: 291 DLSYNQLCGEIPTGGHMVQFKAAAYEHNKCLCGTPLPPC 329 >ref|XP_002448030.1| hypothetical protein SORBIDRAFT_06g019870 [Sorghum bicolor] gi|241939213|gb|EES12358.1| hypothetical protein SORBIDRAFT_06g019870 [Sorghum bicolor] Length = 335 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 ++SYN LCGEIPTGG M QF A++Y HNKCLCGTPLPPC+ Sbjct: 295 DLSYNDLCGEIPTGGHMVQFKAAAYEHNKCLCGTPLPPCR 334 >gb|ACB30360.1| PGIP [Capsicum annuum] Length = 265 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN LCG+IP GG M +FD SY HNKCLCG PLPPCK Sbjct: 226 NVSYNSLCGKIPQGGSMQRFDQYSYFHNKCLCGAPLPPCK 265 >gb|AFN53656.1| putative serine-threonine protein kinase [Linum usitatissimum] Length = 334 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCGEIPTGG + FD+++Y HN+CLCG+PL PCK Sbjct: 295 NVSYNRLCGEIPTGGKLQSFDSTAYFHNRCLCGSPLEPCK 334 >gb|ADV16115.1| polygalacturonase inhibitor protein, partial [Carica papaya] gi|318055985|gb|ADV36223.1| polygalacturonase inhibiting protein 2 [Carica papaya] gi|318055989|gb|ADV36225.1| polygalacturonase inhibiting protein 2 [Carica papaya] gi|373879866|gb|AEY77672.1| polygalacturonase-inhibiting protein 6 [Carica papaya] Length = 326 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCGEIP GG + +FD ++Y HN+CLCG PLPPCK Sbjct: 287 NVSYNRLCGEIPVGGDLQRFDYTAYFHNRCLCGAPLPPCK 326 >gb|AAT77777.1| polygalacturonase inhibitor protein [Carica papaya] Length = 338 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCGEIP GG + +FD ++Y HN+CLCG PLPPCK Sbjct: 299 NVSYNRLCGEIPVGGDLQRFDYTAYFHNRCLCGAPLPPCK 338 >ref|XP_006850091.1| hypothetical protein AMTR_s00022p00220000 [Amborella trichopoda] gi|548853689|gb|ERN11672.1| hypothetical protein AMTR_s00022p00220000 [Amborella trichopoda] Length = 332 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 N SYN+LCG IP GG M +FDASSYIHNKCLCG+PLP C Sbjct: 293 NASYNRLCGAIPQGGEMKRFDASSYIHNKCLCGSPLPAC 331 >gb|ABA29012.1| polygalacturonase inhibitor [Solanum palustre] Length = 307 Score = 73.2 bits (178), Expect = 3e-11 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG+IP GG + FDA SY+HNKCLCG+PLP CK Sbjct: 268 NVSYNRLCGQIPQGGTLQSFDAYSYLHNKCLCGSPLPDCK 307 >ref|XP_004973874.1| PREDICTED: polygalacturonase inhibitor 1-like [Setaria italica] Length = 335 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN LCGEIPTG M A SY+HNKCLCGTPLPPCK Sbjct: 293 NVSYNDLCGEIPTGRFMIYHGADSYVHNKCLCGTPLPPCK 332 >gb|AFW75085.1| hypothetical protein ZEAMMB73_943639 [Zea mays] Length = 350 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 NVSYN++CG +PTGG M++FDA SY HNKCLCGTPLP C Sbjct: 307 NVSYNKMCGVVPTGGSMAKFDAYSYQHNKCLCGTPLPAC 345 >gb|ABO26221.1| polygalacturonase inhibiting protein [Prunus persica] Length = 330 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG+IP GG + FD+S+YIHN+CLCG PLP CK Sbjct: 291 NVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCGAPLPSCK 330 >emb|CAF04489.1| putative polygalacturonase-inhibiting protein [synthetic construct] Length = 332 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG+IP GG + FD +SY HN+CLCGTPLP CK Sbjct: 293 NVSYNRLCGQIPVGGKLQSFDNTSYFHNRCLCGTPLPSCK 332 >ref|XP_006346175.1| PREDICTED: polygalacturonase inhibitor-like [Solanum tuberosum] Length = 328 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG+IP GG + FD SY+HNKCLCG+PLP CK Sbjct: 289 NVSYNRLCGQIPQGGTLQSFDVYSYLHNKCLCGSPLPDCK 328 >gb|ABA29013.1| polygalacturonase inhibitor [Solanum palustre] Length = 307 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG+IP GG + FD SY+HNKCLCG+PLP CK Sbjct: 268 NVSYNRLCGQIPQGGTLQSFDVYSYLHNKCLCGSPLPDCK 307 >gb|AAT77428.2| polygalacturonase inhibitor protein precursor [Solanum palustre] gi|75859936|gb|ABA29014.1| polygalacturonase inhibitor [Solanum palustre] Length = 307 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG+IP GG + FD SY+HNKCLCG+PLP CK Sbjct: 268 NVSYNRLCGQIPQGGTLQSFDVYSYLHNKCLCGSPLPDCK 307 >tpg|DAA37343.1| TPA: hypothetical protein ZEAMMB73_259111 [Zea mays] Length = 336 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 ++SYN LCG+IPTGG M QF A++Y HNKCLCGTPLPPC Sbjct: 294 DLSYNDLCGKIPTGGHMVQFKAAAYEHNKCLCGTPLPPC 332 >dbj|BAK00896.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 336 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPCK 314 NVSYN+LCG +PTGG M++FD ++ HNKCLCG PLPPCK Sbjct: 296 NVSYNRLCGAVPTGGNMARFDLYNFQHNKCLCGAPLPPCK 335 >gb|ACU20006.1| unknown [Glycine max] Length = 332 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 NVS+N LCGEIP GG M +FD SSY +NKCLCG+PLPPC Sbjct: 293 NVSFNDLCGEIPQGGNMQRFDVSSYANNKCLCGSPLPPC 331 >ref|XP_002439097.1| hypothetical protein SORBIDRAFT_09g000430 [Sorghum bicolor] gi|241944382|gb|EES17527.1| hypothetical protein SORBIDRAFT_09g000430 [Sorghum bicolor] Length = 356 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 NVSYN++CG +PTGG M +FDA SY HNKCLCGTPLP C Sbjct: 313 NVSYNKMCGVVPTGGNMDKFDAYSYQHNKCLCGTPLPSC 351 >ref|XP_003531065.1| PREDICTED: polygalacturonase inhibitor 2 [Glycine max] gi|110836647|emb|CAI99394.1| polygalacturonase inhibiting protein precursor [Glycine max] Length = 332 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 433 NVSYNQLCGEIPTGGPMSQFDASSYIHNKCLCGTPLPPC 317 NVS+N LCGEIP GG M +FD SSY +NKCLCG+PLPPC Sbjct: 293 NVSFNDLCGEIPQGGNMQRFDVSSYANNKCLCGSPLPPC 331