BLASTX nr result
ID: Sinomenium22_contig00060468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00060468 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON68771.1| hypothetical protein W97_08029 [Coniosporium apol... 65 8e-09 gb|EOA91123.1| hypothetical protein SETTUDRAFT_166928 [Setosphae... 65 8e-09 gb|EKG18045.1| hypothetical protein MPH_04735 [Macrophomina phas... 63 5e-08 ref|XP_007581635.1| hypothetical protein UCRNP2_2330 [Neofusicoc... 56 5e-06 >gb|EON68771.1| hypothetical protein W97_08029 [Coniosporium apollinis CBS 100218] Length = 156 Score = 65.5 bits (158), Expect = 8e-09 Identities = 41/89 (46%), Positives = 56/89 (62%), Gaps = 5/89 (5%) Frame = +1 Query: 16 ASKPNFND-----LASRERPPKPPTDQFERLGLTESQKNNKFLTSRLGSSRSNKMPVHPA 180 A++P+F++ A +++ P + F+ TE+ N + R S+ N MPVHP+ Sbjct: 6 ANQPSFHERIQDYYAQKDKHYDPIINAFKDAN-TEADSNEATVPIR---SKDN-MPVHPS 60 Query: 181 EENATGNITDQVAKESGDSTASTHEHHQE 267 EE A GN+TDQVAKES DSTASTHE HQE Sbjct: 61 EEVAEGNLTDQVAKESSDSTASTHELHQE 89 >gb|EOA91123.1| hypothetical protein SETTUDRAFT_166928 [Setosphaeria turcica Et28A] Length = 80 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 163 MPVHPAEENATGNITDQVAKESGDSTASTHEHH 261 MPVHPAEE A+GNITDQVAKES DSTASTH+HH Sbjct: 1 MPVHPAEETASGNITDQVAKESSDSTASTHQHH 33 >gb|EKG18045.1| hypothetical protein MPH_04735 [Macrophomina phaseolina MS6] Length = 83 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 163 MPVHPAEENATGNITDQVAKESGDSTASTHEHHQ 264 MPVHPAEENATG+ITDQVAKES DSTAS+H HQ Sbjct: 1 MPVHPAEENATGSITDQVAKESSDSTASSHAMHQ 34 >ref|XP_007581635.1| hypothetical protein UCRNP2_2330 [Neofusicoccum parvum UCRNP2] gi|485926638|gb|EOD50869.1| hypothetical protein UCRNP2_2330 [Neofusicoccum parvum UCRNP2] Length = 83 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 163 MPVHPAEENATGNITDQVAKESGDSTASTHEHHQ 264 MP HPAEEN TG+ITD+VAKES DS ASTH HQ Sbjct: 1 MPHHPAEENTTGDITDKVAKESSDSNASTHPLHQ 34