BLASTX nr result
ID: Sinomenium22_contig00060313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00060313 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522317.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_002307253.2| hypothetical protein POPTR_0005s14230g, part... 59 5e-07 ref|XP_006425838.1| hypothetical protein CICLE_v10027149mg [Citr... 59 7e-07 >ref|XP_002522317.1| conserved hypothetical protein [Ricinus communis] gi|223538395|gb|EEF40001.1| conserved hypothetical protein [Ricinus communis] Length = 414 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 277 RAKDSAMQSWLDSKPLIDHLEKLQSDLVNAKNRSS 381 RAKDSAMQSWLDSKPLID LEKLQ+ L ++KNR+S Sbjct: 34 RAKDSAMQSWLDSKPLIDELEKLQAGLASSKNRTS 68 >ref|XP_002307253.2| hypothetical protein POPTR_0005s14230g, partial [Populus trichocarpa] gi|550338902|gb|EEE94249.2| hypothetical protein POPTR_0005s14230g, partial [Populus trichocarpa] Length = 295 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 271 IKRAKDSAMQSWLDSKPLIDHLEKLQSDLVNAKNRSS 381 +++AKD AMQSWLDS+PLID LEKLQS L +AKNR+S Sbjct: 46 LQKAKDEAMQSWLDSRPLIDELEKLQSGLASAKNRAS 82 >ref|XP_006425838.1| hypothetical protein CICLE_v10027149mg [Citrus clementina] gi|557527828|gb|ESR39078.1| hypothetical protein CICLE_v10027149mg [Citrus clementina] Length = 330 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 271 IKRAKDSAMQSWLDSKPLIDHLEKLQSDLVNAKNRSS 381 +KRAKD+AMQSWLDSKPLID LE+L++ L +AKNR S Sbjct: 27 LKRAKDNAMQSWLDSKPLIDELERLKATLASAKNRCS 63