BLASTX nr result
ID: Sinomenium22_contig00060196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00060196 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELW70377.1| hypothetical protein TREES_T100002604 [Tupaia chi... 56 6e-06 >gb|ELW70377.1| hypothetical protein TREES_T100002604 [Tupaia chinensis] Length = 203 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/84 (40%), Positives = 51/84 (60%), Gaps = 2/84 (2%) Frame = +3 Query: 6 RREERIEGYKSCESRVRDERRDQMAVRLVERDDNETRVE-RAEGKTSGEKRRQDERQQSK 182 RREE+ G K E R+E+R + R +R + E R E R E K GEKRR++ER++ K Sbjct: 46 RREEKRRGEKRREEERREEKRREEKRRGEKRREEERREEKRREEKRRGEKRREEERREEK 105 Query: 183 WRHVEKR-DKRSEGEKRSKRAEDE 251 R ++R +KR E E+R ++ +E Sbjct: 106 RREEKRRGEKRREEERREEKRREE 129