BLASTX nr result
ID: Sinomenium22_contig00059931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00059931 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504926.1| PREDICTED: cannabidiolic acid synthase-like ... 69 7e-10 ref|XP_002277281.2| PREDICTED: reticuline oxidase-like protein-l... 65 7e-09 emb|CBI22013.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_002523160.1| Reticuline oxidase precursor, putative [Rici... 65 7e-09 ref|XP_007212927.1| hypothetical protein PRUPE_ppa022422mg, part... 65 1e-08 ref|XP_006398055.1| hypothetical protein EUTSA_v10000845mg [Eutr... 64 2e-08 ref|NP_199254.1| FAD-binding Berberine family protein [Arabidops... 64 2e-08 dbj|BAE99575.1| berberine bridge enzyme-like protein [Arabidopsi... 64 2e-08 ref|XP_003637115.1| Reticuline oxidase [Medicago truncatula] gi|... 64 3e-08 ref|XP_002317088.2| hypothetical protein POPTR_0011s16190g [Popu... 63 4e-08 ref|XP_006280280.1| hypothetical protein CARUB_v10026203mg [Caps... 63 4e-08 ref|XP_002863579.1| FAD-binding domain-containing protein [Arabi... 63 4e-08 ref|XP_006370482.1| FAD-binding domain-containing family protein... 63 4e-08 ref|XP_006468356.1| PREDICTED: tetrahydrocannabinolic acid synth... 63 5e-08 ref|XP_007148667.1| hypothetical protein PHAVU_005G004700g [Phas... 63 5e-08 ref|XP_007148666.1| hypothetical protein PHAVU_005G004600g [Phas... 63 5e-08 ref|XP_006448861.1| hypothetical protein CICLE_v10017845mg [Citr... 63 5e-08 ref|XP_003523849.1| PREDICTED: cannabidiolic acid synthase-like ... 63 5e-08 gb|EYU19096.1| hypothetical protein MIMGU_mgv1a004131mg [Mimulus... 62 6e-08 ref|XP_003598284.1| FAD-linked oxidoreductase [Medicago truncatu... 62 6e-08 >ref|XP_004504926.1| PREDICTED: cannabidiolic acid synthase-like 2-like [Cicer arietinum] Length = 562 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 V+IL PYGGRM EI+ESEIPFPHR GNIY IQ LVFW ++ Sbjct: 404 VLILTPYGGRMDEISESEIPFPHRAGNIYKIQYLVFWQEE 443 >ref|XP_002277281.2| PREDICTED: reticuline oxidase-like protein-like [Vitis vinifera] Length = 531 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 +MIL PYGGRM+EI+E+E+PFPHR+GN+Y IQ LV W+++ Sbjct: 396 IMILSPYGGRMNEISETEVPFPHRKGNLYKIQYLVSWDEE 435 >emb|CBI22013.3| unnamed protein product [Vitis vinifera] Length = 417 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 +MIL PYGGRM+EI+E+E+PFPHR+GN+Y IQ LV W+++ Sbjct: 267 IMILSPYGGRMNEISETEVPFPHRKGNLYKIQYLVSWDEE 306 >ref|XP_002523160.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537567|gb|EEF39191.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 540 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWN 289 ++IL PYGGRMSEI+ESEIPFPHR GN+Y IQ LV W+ Sbjct: 400 MLILTPYGGRMSEISESEIPFPHRNGNLYKIQYLVTWD 437 >ref|XP_007212927.1| hypothetical protein PRUPE_ppa022422mg, partial [Prunus persica] gi|462408792|gb|EMJ14126.1| hypothetical protein PRUPE_ppa022422mg, partial [Prunus persica] Length = 372 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWN 289 +IL PYGGRMSEI+ SE PFPHR+GN++ IQ LVFWN Sbjct: 293 LILTPYGGRMSEISASETPFPHRKGNLFEIQYLVFWN 329 >ref|XP_006398055.1| hypothetical protein EUTSA_v10000845mg [Eutrema salsugineum] gi|557099144|gb|ESQ39508.1| hypothetical protein EUTSA_v10000845mg [Eutrema salsugineum] Length = 540 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNK 286 +IL P+GG+MSEIA+ EIPFPHREGN+Y IQ L +WN+ Sbjct: 401 IILTPFGGKMSEIADYEIPFPHREGNLYEIQYLAYWNE 438 >ref|NP_199254.1| FAD-binding Berberine family protein [Arabidopsis thaliana] gi|9758693|dbj|BAB09147.1| berberine bridge enzyme-like protein [Arabidopsis thaliana] gi|332007723|gb|AED95106.1| tetrahydroberberine oxidase-like protein [Arabidopsis thaliana] Length = 535 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 +IL P+GG+MSEIA++EIPFPHREGN+Y IQ L +W+++ Sbjct: 397 IILTPFGGKMSEIADNEIPFPHREGNLYEIQYLAYWSEE 435 >dbj|BAE99575.1| berberine bridge enzyme-like protein [Arabidopsis thaliana] Length = 513 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 +IL P+GG+MSEIA++EIPFPHREGN+Y IQ L +W+++ Sbjct: 375 IILTPFGGKMSEIADNEIPFPHREGNLYEIQYLAYWSEE 413 >ref|XP_003637115.1| Reticuline oxidase [Medicago truncatula] gi|355503050|gb|AES84253.1| Reticuline oxidase [Medicago truncatula] Length = 576 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 V+I PYGG M EI+ESEIPFPHR GNIY IQ LVFW ++ Sbjct: 415 VLIFTPYGGIMDEISESEIPFPHRAGNIYQIQHLVFWKEE 454 >ref|XP_002317088.2| hypothetical protein POPTR_0011s16190g [Populus trichocarpa] gi|550328514|gb|EEE97700.2| hypothetical protein POPTR_0011s16190g [Populus trichocarpa] Length = 538 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWN 289 ++IL PYGGRMSEI++SEIPFPHR GNI+ IQ L+ W+ Sbjct: 401 MLILTPYGGRMSEISDSEIPFPHRSGNIFKIQYLITWD 438 >ref|XP_006280280.1| hypothetical protein CARUB_v10026203mg [Capsella rubella] gi|482548984|gb|EOA13178.1| hypothetical protein CARUB_v10026203mg [Capsella rubella] Length = 538 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 +IL P+GG+MSEIAESE PFPHR+GN+Y IQ L +W+++ Sbjct: 398 IILTPFGGKMSEIAESETPFPHRKGNVYEIQYLAYWSEE 436 >ref|XP_002863579.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309414|gb|EFH39838.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 536 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 +IL P+GG+MSEIAE E PFPHREGN+Y IQ L FW ++ Sbjct: 399 VILTPFGGKMSEIAEHETPFPHREGNLYEIQYLAFWREE 437 >ref|XP_006370482.1| FAD-binding domain-containing family protein [Populus trichocarpa] gi|550349675|gb|ERP67051.1| FAD-binding domain-containing family protein [Populus trichocarpa] Length = 527 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 ++I PYGG+MSEI+ES IPFPHR GNIY IQ L++W+++ Sbjct: 395 ILIFSPYGGKMSEISESSIPFPHRAGNIYKIQHLIYWDEE 434 >ref|XP_006468356.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Citrus sinensis] Length = 531 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 V+IL PYGGRMSEI++SEI FPHR+GNIY+IQ L W+++ Sbjct: 403 VLILTPYGGRMSEISDSEIAFPHRKGNIYAIQYLTNWDEE 442 >ref|XP_007148667.1| hypothetical protein PHAVU_005G004700g [Phaseolus vulgaris] gi|561021931|gb|ESW20661.1| hypothetical protein PHAVU_005G004700g [Phaseolus vulgaris] Length = 533 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFW 292 ++I+ PYGGRM+EI+ESEIPFPHR+GN+Y+IQ LV W Sbjct: 395 MLIMEPYGGRMNEISESEIPFPHRKGNLYNIQYLVKW 431 >ref|XP_007148666.1| hypothetical protein PHAVU_005G004600g [Phaseolus vulgaris] gi|561021930|gb|ESW20660.1| hypothetical protein PHAVU_005G004600g [Phaseolus vulgaris] Length = 514 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFW 292 ++I+ PYGGRM+EI+ESEIPFPHR+GN+Y+IQ LV W Sbjct: 378 MLIMEPYGGRMNEISESEIPFPHRKGNLYNIQYLVKW 414 >ref|XP_006448861.1| hypothetical protein CICLE_v10017845mg [Citrus clementina] gi|557551472|gb|ESR62101.1| hypothetical protein CICLE_v10017845mg [Citrus clementina] Length = 531 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 V+IL PYGGRMSEI++SEI FPHR+GNIY+IQ L W+++ Sbjct: 403 VLILTPYGGRMSEISDSEIAFPHRKGNIYAIQYLTNWDEE 442 >ref|XP_003523849.1| PREDICTED: cannabidiolic acid synthase-like [Glycine max] Length = 528 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 399 MILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKKIK 277 +I+ PYGGRM+EI+ESEIPFPHR+GN+YSI+ +V W + K Sbjct: 396 LIMEPYGGRMNEISESEIPFPHRKGNLYSIEYVVKWEQNSK 436 >gb|EYU19096.1| hypothetical protein MIMGU_mgv1a004131mg [Mimulus guttatus] Length = 543 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKK 283 V+I PYGGRM E+ ES IPFPHR GN+Y IQ LV+W K+ Sbjct: 408 VVIFSPYGGRMDEVPESSIPFPHRAGNLYKIQHLVYWEKE 447 >ref|XP_003598284.1| FAD-linked oxidoreductase [Medicago truncatula] gi|355487332|gb|AES68535.1| FAD-linked oxidoreductase [Medicago truncatula] Length = 590 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 402 VMILIPYGGRMSEIAESEIPFPHREGNIYSIQLLVFWNKKIKSIIE 265 ++I+ PYGG+MSEI+ESEIPFPHR+GN+Y+IQ +V W ++ SI E Sbjct: 392 LLIMEPYGGKMSEISESEIPFPHRKGNLYNIQYMVKW--EVNSIEE 435