BLASTX nr result
ID: Sinomenium22_contig00059708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00059708 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78969.1| hypothetical protein (mitochondrion) [Vicia faba]... 82 8e-14 ref|XP_002535003.1| conserved hypothetical protein [Ricinus comm... 66 6e-09 ref|XP_002539514.1| conserved hypothetical protein [Ricinus comm... 66 6e-09 ref|XP_002540127.1| conserved hypothetical protein [Ricinus comm... 66 6e-09 gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] 59 7e-07 ref|XP_006857105.1| hypothetical protein AMTR_s00065p00126250 [A... 42 1e-06 >gb|AGC78969.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803261|gb|AGC78996.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 103 Score = 82.0 bits (201), Expect = 8e-14 Identities = 45/72 (62%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = -3 Query: 308 PLLTKCPSLGWGNTAHE*F----APPFAGCRPRWSWEPTYTDFPGACLAPTSKSRAGAEK 141 P LT +LGWG TA P AGCRPR+SWEP DFPGACLAPTSK AGAE Sbjct: 38 PTLT---ALGWGKTAMSSSLQDPTPSRAGCRPRFSWEP---DFPGACLAPTSKKNAGAEP 91 Query: 140 EPAQPLQESFAW 105 + QPLQESFAW Sbjct: 92 KRNQPLQESFAW 103 >ref|XP_002535003.1| conserved hypothetical protein [Ricinus communis] gi|223524217|gb|EEF27385.1| conserved hypothetical protein [Ricinus communis] Length = 81 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 305 LLTKCPSLGWGNTAH----E*FAPPFAGCRPRWSWEPTYTDFPGACLAPTSKSRAGAEKE 138 LLTKCPS GWGNTA + P AGCRPRWSWEPTYT A K RA K+ Sbjct: 2 LLTKCPSWGWGNTAMSSSLQDSTPSRAGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQ 61 Query: 137 PA 132 P+ Sbjct: 62 PS 63 >ref|XP_002539514.1| conserved hypothetical protein [Ricinus communis] gi|223505440|gb|EEF22868.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 305 LLTKCPSLGWGNTAH----E*FAPPFAGCRPRWSWEPTYTDFPGACLAPTSKSRAGAEKE 138 LLTKCPS GWGNTA + P AGCRPRWSWEPTYT A K RA K+ Sbjct: 45 LLTKCPSWGWGNTAMSSSLQDSTPSRAGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQ 104 Query: 137 PA 132 P+ Sbjct: 105 PS 106 >ref|XP_002540127.1| conserved hypothetical protein [Ricinus communis] gi|223498957|gb|EEF22255.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 305 LLTKCPSLGWGNTAH----E*FAPPFAGCRPRWSWEPTYTDFPGACLAPTSKSRAGAEKE 138 LLTKCPS GWGNTA + P AGCRPRWSWEPTYT A K RA K+ Sbjct: 29 LLTKCPSWGWGNTAMSSSLQDSTPSRAGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQ 88 Query: 137 PA 132 P+ Sbjct: 89 PS 90 >gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] Length = 478 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 208 QPILTFLGLALPQHLNQGRAPKRNQPSLFKKA 113 +P TFLGLALPQHLN+ RAPKRNQPSLFKKA Sbjct: 310 EPTYTFLGLALPQHLNKRRAPKRNQPSLFKKA 341 >ref|XP_006857105.1| hypothetical protein AMTR_s00065p00126250 [Amborella trichopoda] gi|548861188|gb|ERN18572.1| hypothetical protein AMTR_s00065p00126250 [Amborella trichopoda] Length = 90 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 83 DNALNTKVCSSAPFSHAESQAAPRK 9 +NALNT V SSAPFSHAES AAPRK Sbjct: 42 NNALNTFVFSSAPFSHAESLAAPRK 66 Score = 35.4 bits (80), Expect(2) = 1e-06 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = -1 Query: 199 LTFLGLALPQ---HLNQGRAPKRNQPSLFKKA 113 L L L LP ++ RAPKRNQPSLFKKA Sbjct: 3 LAILSLGLPCLNIYIRGSRAPKRNQPSLFKKA 34