BLASTX nr result
ID: Sinomenium22_contig00059224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00059224 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17453.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 >emb|CBI17453.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/61 (49%), Positives = 36/61 (59%) Frame = +1 Query: 121 FRRGLDQSSFXXXXXXXXXXXXXVPIDPYPRRLFDHTHNPNAFLFTALIRAYSLLGPFHE 300 FR+GL+Q F VP+DPYPR +F PN FL+TALIR Y+L GPF E Sbjct: 63 FRKGLEQCCFVLAKLLRTLTKLDVPMDPYPRLVFQQVEYPNPFLWTALIRGYALQGPFME 122 Query: 301 S 303 S Sbjct: 123 S 123 >ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Vitis vinifera] Length = 647 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/61 (49%), Positives = 36/61 (59%) Frame = +1 Query: 121 FRRGLDQSSFXXXXXXXXXXXXXVPIDPYPRRLFDHTHNPNAFLFTALIRAYSLLGPFHE 300 FR+GL+Q F VP+DPYPR +F PN FL+TALIR Y+L GPF E Sbjct: 63 FRKGLEQCCFVLAKLLRTLTKLDVPMDPYPRLVFQQVEYPNPFLWTALIRGYALQGPFME 122 Query: 301 S 303 S Sbjct: 123 S 123