BLASTX nr result
ID: Sinomenium22_contig00058927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058927 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ57270.1| 26S proteasome regulatory subunit N4 [Cladophialo... 65 8e-09 gb|ETI25692.1| hypothetical protein G647_02466 [Cladophialophora... 65 8e-09 gb|EXJ75489.1| 26S proteasome regulatory subunit N4 [Cladophialo... 65 1e-08 gb|ETN41192.1| hypothetical protein HMPREF1541_03127 [Cyphelloph... 64 2e-08 gb|EXJ87994.1| hypothetical protein A1O1_04921 [Capronia coronat... 62 6e-08 gb|EXJ86683.1| hypothetical protein A1O3_03636 [Capronia epimyce... 62 6e-08 gb|EHY53630.1| 26S proteasome regulatory subunit N4 [Exophiala d... 62 6e-08 ref|XP_002146149.1| C2H2 transcription factor (Rpn4), putative [... 62 8e-08 gb|EGC43637.1| C2H2 transcription factor [Ajellomyces capsulatus... 62 1e-07 gb|EEH08594.1| conserved hypothetical protein [Ajellomyces capsu... 62 1e-07 ref|XP_001539105.1| predicted protein [Ajellomyces capsulatus NA... 62 1e-07 gb|EQL34353.1| hypothetical protein BDFG_03712 [Ajellomyces derm... 60 2e-07 gb|EGE80039.1| C2H2 transcription factor [Ajellomyces dermatitid... 60 2e-07 gb|EEQ84209.1| C2H2 transcription factor [Ajellomyces dermatitid... 60 2e-07 ref|XP_002626831.1| C2H2 transcription factor [Ajellomyces derma... 60 2e-07 dbj|GAD96575.1| C2H2 transcription factor (Rpn4), putative [Byss... 60 3e-07 ref|XP_002478439.1| C2H2 transcription factor (Rpn4), putative [... 59 7e-07 gb|EEH44576.1| conserved hypothetical protein [Paracoccidioides ... 58 1e-06 ref|XP_002790854.1| conserved hypothetical protein [Paracoccidio... 58 1e-06 gb|EEH20181.1| C2H2 transcription factor (Rpn4) [Paracoccidioide... 58 1e-06 >gb|EXJ57270.1| 26S proteasome regulatory subunit N4 [Cladophialophora yegresii CBS 114405] Length = 526 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHPDVDWVGKQKRKS Sbjct: 495 KTFSRNDALTRHMRVVHPDVDWVGKQKRKS 524 >gb|ETI25692.1| hypothetical protein G647_02466 [Cladophialophora carrionii CBS 160.54] Length = 526 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHPDVDWVGKQKRKS Sbjct: 495 KTFSRNDALTRHMRVVHPDVDWVGKQKRKS 524 >gb|EXJ75489.1| 26S proteasome regulatory subunit N4 [Cladophialophora psammophila CBS 110553] Length = 529 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKSHR 315 KTFSRNDALTRH+RVVHPDVDWVGKQKRK+ + Sbjct: 498 KTFSRNDALTRHMRVVHPDVDWVGKQKRKNQK 529 >gb|ETN41192.1| hypothetical protein HMPREF1541_03127 [Cyphellophora europaea CBS 101466] Length = 432 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKSHR 315 KTFSRNDALTRH+RVVHPDVDWVGKQKR+S + Sbjct: 400 KTFSRNDALTRHMRVVHPDVDWVGKQKRESSK 431 >gb|EXJ87994.1| hypothetical protein A1O1_04921 [Capronia coronata CBS 617.96] Length = 429 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHPDV+WVGKQKRK+ Sbjct: 398 KTFSRNDALTRHMRVVHPDVNWVGKQKRKN 427 >gb|EXJ86683.1| hypothetical protein A1O3_03636 [Capronia epimyces CBS 606.96] Length = 518 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHPDV+WVGKQKRK+ Sbjct: 487 KTFSRNDALTRHMRVVHPDVNWVGKQKRKN 516 >gb|EHY53630.1| 26S proteasome regulatory subunit N4 [Exophiala dermatitidis NIH/UT8656] Length = 542 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHPDV+WVGKQKRK+ Sbjct: 511 KTFSRNDALTRHMRVVHPDVNWVGKQKRKN 540 >ref|XP_002146149.1| C2H2 transcription factor (Rpn4), putative [Talaromyces marneffei ATCC 18224] gi|210071513|gb|EEA25602.1| C2H2 transcription factor (Rpn4), putative [Talaromyces marneffei ATCC 18224] Length = 720 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKSH 318 KTFSRNDALTRH+RVVHP+VDW GKQ+RK H Sbjct: 690 KTFSRNDALTRHMRVVHPEVDWPGKQRRKGH 720 >gb|EGC43637.1| C2H2 transcription factor [Ajellomyces capsulatus H88] Length = 819 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRKS Sbjct: 788 KTFSRNDALTRHMRVVHPEVDWPGKQKRKS 817 >gb|EEH08594.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] Length = 842 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRKS Sbjct: 811 KTFSRNDALTRHMRVVHPEVDWPGKQKRKS 840 >ref|XP_001539105.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150414178|gb|EDN09543.1| predicted protein [Ajellomyces capsulatus NAm1] Length = 556 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRKS Sbjct: 525 KTFSRNDALTRHMRVVHPEVDWPGKQKRKS 554 >gb|EQL34353.1| hypothetical protein BDFG_03712 [Ajellomyces dermatitidis ATCC 26199] Length = 795 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRK+ Sbjct: 764 KTFSRNDALTRHMRVVHPEVDWPGKQKRKA 793 >gb|EGE80039.1| C2H2 transcription factor [Ajellomyces dermatitidis ATCC 18188] Length = 815 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRK+ Sbjct: 784 KTFSRNDALTRHMRVVHPEVDWPGKQKRKA 813 >gb|EEQ84209.1| C2H2 transcription factor [Ajellomyces dermatitidis ER-3] Length = 816 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRK+ Sbjct: 785 KTFSRNDALTRHMRVVHPEVDWPGKQKRKA 814 >ref|XP_002626831.1| C2H2 transcription factor [Ajellomyces dermatitidis SLH14081] gi|239593903|gb|EEQ76484.1| C2H2 transcription factor [Ajellomyces dermatitidis SLH14081] Length = 816 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRKS 321 KTFSRNDALTRH+RVVHP+VDW GKQKRK+ Sbjct: 785 KTFSRNDALTRHMRVVHPEVDWPGKQKRKA 814 >dbj|GAD96575.1| C2H2 transcription factor (Rpn4), putative [Byssochlamys spectabilis No. 5] Length = 743 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRK 324 KTFSRNDALTRH+RVVHP+VDW GKQKRK Sbjct: 712 KTFSRNDALTRHMRVVHPEVDWPGKQKRK 740 >ref|XP_002478439.1| C2H2 transcription factor (Rpn4), putative [Talaromyces stipitatus ATCC 10500] gi|218722058|gb|EED21476.1| C2H2 transcription factor (Rpn4), putative [Talaromyces stipitatus ATCC 10500] Length = 734 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRK 324 KTFSRNDALTRH+RVVHP+VDW GKQ+RK Sbjct: 703 KTFSRNDALTRHMRVVHPEVDWPGKQRRK 731 >gb|EEH44576.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18] Length = 855 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRK 324 KTFSRNDALTRH+RVVHP VDW GKQ+RK Sbjct: 822 KTFSRNDALTRHMRVVHPQVDWPGKQRRK 850 >ref|XP_002790854.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226281106|gb|EEH36672.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 713 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRK 324 KTFSRNDALTRH+RVVHP VDW GKQ+RK Sbjct: 680 KTFSRNDALTRHMRVVHPQVDWPGKQRRK 708 >gb|EEH20181.1| C2H2 transcription factor (Rpn4) [Paracoccidioides brasiliensis Pb03] Length = 869 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 410 KTFSRNDALTRHVRVVHPDVDWVGKQKRK 324 KTFSRNDALTRH+RVVHP VDW GKQ+RK Sbjct: 836 KTFSRNDALTRHMRVVHPQVDWPGKQRRK 864