BLASTX nr result
ID: Sinomenium22_contig00058828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058828 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293678.1| PREDICTED: protein CHUP1, chloroplastic-like... 62 6e-08 ref|XP_006448814.1| hypothetical protein CICLE_v10014330mg [Citr... 59 5e-07 ref|XP_002268607.1| PREDICTED: protein CHUP1, chloroplastic-like... 59 5e-07 emb|CBI31084.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_007213645.1| hypothetical protein PRUPE_ppa001630mg [Prun... 58 1e-06 ref|XP_006468374.1| PREDICTED: protein CHUP1, chloroplastic-like... 58 2e-06 >ref|XP_004293678.1| PREDICTED: protein CHUP1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 777 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 6/71 (8%) Frame = +1 Query: 136 KSNPKVLELERELEASKKVADDLSERVGLLEAAKASLSEQLVSVPS------SREDQENY 297 K NP+VLELERELEA ++ D + +V +LE KASL+EQLVS+ REDQE Sbjct: 151 KRNPRVLELERELEAKRRELDGVMRKVEVLEEEKASLAEQLVSISERSEEVLKREDQECG 210 Query: 298 LAPINGNLEME 330 + +G++EME Sbjct: 211 VVSASGSVEME 221 >ref|XP_006448814.1| hypothetical protein CICLE_v10014330mg [Citrus clementina] gi|557551425|gb|ESR62054.1| hypothetical protein CICLE_v10014330mg [Citrus clementina] Length = 790 Score = 59.3 bits (142), Expect = 5e-07 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +1 Query: 133 YKSNPKVLELERELEASKKVADDLSERVGLLEAAKASLSEQLVS---VPSSREDQENYL- 300 +K NPKVLELERELEA K D++ RVG+LE K SLSEQL + + + D EN + Sbjct: 151 WKRNPKVLELERELEAKKIENDEIVRRVGMLEDEKTSLSEQLAALSVILERKNDNENAIN 210 Query: 301 --APINGNLEME 330 + + NLEME Sbjct: 211 MGSSSSQNLEME 222 >ref|XP_002268607.1| PREDICTED: protein CHUP1, chloroplastic-like [Vitis vinifera] Length = 801 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = +1 Query: 133 YKSNPKVLELERELEASKKVADDLSERVGLLEAAKASLSEQLVSVPS---------SRED 285 +K NP++L+LERELE K ++LS++V LLE+ K SLSEQL + S RED Sbjct: 144 FKRNPEILDLERELEVKKSEVNELSQKVRLLESEKTSLSEQLSGLASIAERREELLKRED 203 Query: 286 QENYLAPINGNLEME 330 E AP LEME Sbjct: 204 LEISSAPSQRTLEME 218 >emb|CBI31084.3| unnamed protein product [Vitis vinifera] Length = 781 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = +1 Query: 133 YKSNPKVLELERELEASKKVADDLSERVGLLEAAKASLSEQLVSVPS---------SRED 285 +K NP++L+LERELE K ++LS++V LLE+ K SLSEQL + S RED Sbjct: 144 FKRNPEILDLERELEVKKSEVNELSQKVRLLESEKTSLSEQLSGLASIAERREELLKRED 203 Query: 286 QENYLAPINGNLEME 330 E AP LEME Sbjct: 204 LEISSAPSQRTLEME 218 >ref|XP_007213645.1| hypothetical protein PRUPE_ppa001630mg [Prunus persica] gi|462409510|gb|EMJ14844.1| hypothetical protein PRUPE_ppa001630mg [Prunus persica] Length = 789 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 10/75 (13%) Frame = +1 Query: 136 KSNPKVLELERELEASKKVADDLSERVGLLEAAKASLSEQLVSVPS----------SRED 285 K NPKVL+LERELE + D L+ +V LLE K SLSEQL ++ S +E+ Sbjct: 151 KRNPKVLDLERELEVKRIELDGLARKVELLEEEKTSLSEQLSALTSILDRNEGVTLKKEE 210 Query: 286 QENYLAPINGNLEME 330 QE+ +A +G++EME Sbjct: 211 QESSVASASGSVEME 225 >ref|XP_006468374.1| PREDICTED: protein CHUP1, chloroplastic-like [Citrus sinensis] Length = 790 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +1 Query: 133 YKSNPKVLELERELEASKKVADDLSERVGLLEAAKASLSEQLVS---VPSSREDQENYL- 300 +K NPKVLELERELEA K D++ RVG+LE K SLSEQL + + + D +N + Sbjct: 151 WKRNPKVLELERELEAKKIENDEIVRRVGMLEDEKTSLSEQLAALSVILERKNDNKNAIN 210 Query: 301 --APINGNLEME 330 + + NLEME Sbjct: 211 MGSSSSQNLEME 222