BLASTX nr result
ID: Sinomenium22_contig00058801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058801 (537 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535493.1| conserved hypothetical protein [Ricinus comm... 79 7e-13 >ref|XP_002535493.1| conserved hypothetical protein [Ricinus communis] gi|223522917|gb|EEF26889.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 79.0 bits (193), Expect = 7e-13 Identities = 40/59 (67%), Positives = 42/59 (71%), Gaps = 8/59 (13%) Frame = +3 Query: 282 QLSDHDCTVSFYASSCSVQDRHTGALIGHGCKCVWAGSITWAVSICY--------WICL 434 QL+DHDCTVSFYASSCSVQDRHT ALI HG K GSITW VSIC W+CL Sbjct: 263 QLTDHDCTVSFYASSCSVQDRHTSALISHGRK--RGGSITWTVSICLLPLLDLLAWVCL 319