BLASTX nr result
ID: Sinomenium22_contig00058550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058550 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] 57 3e-06 >gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] Length = 94 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/49 (42%), Positives = 34/49 (69%) Frame = +1 Query: 58 WIVCNKRIFEDRDRDPHLTWDKIHFNSSIWLYLEEELKSYLFSDILRDW 204 W+ N+RIFE R+ D +TWD+I N ++W++ +E L+SD++RDW Sbjct: 43 WLERNRRIFERREEDSIITWDRIKLNIALWIHSNKEFCDLLYSDLVRDW 91