BLASTX nr result
ID: Sinomenium22_contig00058323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058323 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135929.1| PREDICTED: uncharacterized protein LOC101206... 58 2e-06 gb|EXB32794.1| hypothetical protein L484_012525 [Morus notabilis] 57 3e-06 ref|XP_004308217.1| PREDICTED: uncharacterized protein LOC101311... 57 3e-06 ref|XP_007219852.1| hypothetical protein PRUPE_ppa027055mg [Prun... 55 8e-06 >ref|XP_004135929.1| PREDICTED: uncharacterized protein LOC101206114 [Cucumis sativus] gi|449488854|ref|XP_004158192.1| PREDICTED: uncharacterized protein LOC101231740 [Cucumis sativus] Length = 355 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 103 MEPVKFDWRNVEPRFVEDEIYELISAPKWFDFSA 2 MEP K DW+NV+ RFVEDE+YE I+APKW DF+A Sbjct: 1 MEPAKVDWKNVQWRFVEDELYEHINAPKWVDFTA 34 >gb|EXB32794.1| hypothetical protein L484_012525 [Morus notabilis] Length = 604 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -2 Query: 103 MEPVKFDWRNVEPRFVEDEIYELISAPKWFDF 8 MEP K DW+N+E +FV+DE+YE I+APKWFDF Sbjct: 253 MEPAKIDWKNLEWKFVQDELYEHINAPKWFDF 284 >ref|XP_004308217.1| PREDICTED: uncharacterized protein LOC101311806 [Fragaria vesca subsp. vesca] Length = 612 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 103 MEPVKFDWRNVEPRFVEDEIYELISAPKWFDF 8 MEP K DW+N+E RFVED+ YE I+APKWFDF Sbjct: 1 MEPAKIDWKNLEWRFVEDKAYEQINAPKWFDF 32 >ref|XP_007219852.1| hypothetical protein PRUPE_ppa027055mg [Prunus persica] gi|462416314|gb|EMJ21051.1| hypothetical protein PRUPE_ppa027055mg [Prunus persica] Length = 273 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 103 MEPVKFDWRNVEPRFVEDEIYELISAPKWFDF 8 MEP K DW+N+E +FVED+ YE I+APKWFDF Sbjct: 1 MEPAKIDWKNLEWKFVEDKAYEQINAPKWFDF 32