BLASTX nr result
ID: Sinomenium22_contig00058291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058291 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70693.1| hypothetical protein VITISV_041975 [Vitis vinifera] 60 2e-07 emb|CAN72844.1| hypothetical protein VITISV_009107 [Vitis vinifera] 60 4e-07 emb|CAN77570.1| hypothetical protein VITISV_008516 [Vitis vinifera] 59 7e-07 emb|CAN78983.1| hypothetical protein VITISV_038305 [Vitis vinifera] 59 9e-07 emb|CAN66542.1| hypothetical protein VITISV_035205 [Vitis vinifera] 59 9e-07 emb|CAN64367.1| hypothetical protein VITISV_018691 [Vitis vinifera] 59 9e-07 emb|CAN72837.1| hypothetical protein VITISV_031500 [Vitis vinifera] 59 9e-07 emb|CAN77207.1| hypothetical protein VITISV_014785 [Vitis vinifera] 59 9e-07 emb|CAN78865.1| hypothetical protein VITISV_013346 [Vitis vinifera] 58 1e-06 emb|CAN79629.1| hypothetical protein VITISV_002584 [Vitis vinifera] 58 1e-06 emb|CAN66445.1| hypothetical protein VITISV_003574 [Vitis vinifera] 58 1e-06 emb|CAN65485.1| hypothetical protein VITISV_029475 [Vitis vinifera] 58 1e-06 emb|CAN66166.1| hypothetical protein VITISV_000142 [Vitis vinifera] 58 1e-06 emb|CAN72506.1| hypothetical protein VITISV_027280 [Vitis vinifera] 58 1e-06 emb|CAN83427.1| hypothetical protein VITISV_009103 [Vitis vinifera] 58 2e-06 emb|CAN69984.1| hypothetical protein VITISV_028468 [Vitis vinifera] 57 2e-06 emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] 57 3e-06 emb|CAN75028.1| hypothetical protein VITISV_026823 [Vitis vinifera] 57 3e-06 emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] 57 3e-06 emb|CAN62051.1| hypothetical protein VITISV_016641 [Vitis vinifera] 57 3e-06 >emb|CAN70693.1| hypothetical protein VITISV_041975 [Vitis vinifera] Length = 1795 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/67 (40%), Positives = 41/67 (61%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQCEFAWRICNY 181 KVK F WLV HKK+N+ L+Q + K+L P C LC++ +EST H+F+ C + Sbjct: 1670 KVKSFVWLVAHKKVNTNDLLQLRRPYKALSPDICKLCMRHEESTDHLFLHCSSTMEL--- 1726 Query: 182 WNSIEEL 202 W+ + +L Sbjct: 1727 WHRLFQL 1733 >emb|CAN72844.1| hypothetical protein VITISV_009107 [Vitis vinifera] Length = 506 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K++ P C LC+++ ES HIF+ C Sbjct: 211 KVKAFVWLVTHKKVNTNDLLQLRRPHKAISPDICKLCMEQGESADHIFLHC 261 >emb|CAN77570.1| hypothetical protein VITISV_008516 [Vitis vinifera] Length = 1946 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WL+ HKK+N+ L+Q + +K+L P C LC+++ ES H+F+ C Sbjct: 1560 KVKAFVWLMAHKKVNTNELLQLRRPHKALSPDICKLCMEQGESADHLFLHC 1610 >emb|CAN78983.1| hypothetical protein VITISV_038305 [Vitis vinifera] Length = 973 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K++ P C LC+++ ES H+F+ C Sbjct: 879 KVKAFIWLVAHKKVNTNDLLQLRRPHKAISPDICKLCMEQGESADHLFLHC 929 >emb|CAN66542.1| hypothetical protein VITISV_035205 [Vitis vinifera] Length = 1848 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K++ P C LC+++ ES H+F+ C Sbjct: 1549 KVKAFIWLVAHKKVNTNDLLQLRRPHKAISPDICKLCMEQGESADHLFLHC 1599 >emb|CAN64367.1| hypothetical protein VITISV_018691 [Vitis vinifera] Length = 497 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K+L P C LC ++ ES H+F+ C Sbjct: 430 KVKAFIWLVAHKKVNTNDLLQLRRPHKALSPDICKLCXEQGESADHLFLHC 480 >emb|CAN72837.1| hypothetical protein VITISV_031500 [Vitis vinifera] Length = 982 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K++ P C LC+++ ES H+F+ C Sbjct: 814 KVKAFIWLVAHKKVNTNDLLQLRRPHKAISPDICKLCMEQGESADHLFLHC 864 >emb|CAN77207.1| hypothetical protein VITISV_014785 [Vitis vinifera] Length = 943 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K++ P C LC+++ ES H+F+ C Sbjct: 775 KVKAFIWLVAHKKVNTNDLLQLRRPHKAISPDICKLCMEQGESADHLFLHC 825 >emb|CAN78865.1| hypothetical protein VITISV_013346 [Vitis vinifera] Length = 2935 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/67 (38%), Positives = 40/67 (59%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQCEFAWRICNY 181 KVK F WLV HKK+N+ ++Q + K+L P C LC++ EST H+F+ C + Sbjct: 1443 KVKSFVWLVAHKKVNTNDMLQVRRPYKALSPDICILCIKHGESTDHLFLHCSL---MIGL 1499 Query: 182 WNSIEEL 202 W+ + +L Sbjct: 1500 WHRLFQL 1506 >emb|CAN79629.1| hypothetical protein VITISV_002584 [Vitis vinifera] Length = 964 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K+L P C LC++ +E+ H+F+ C Sbjct: 684 KVKSFVWLVAHKKVNTNDLLQLRRPHKALSPDICKLCMKHEETVDHLFLHC 734 >emb|CAN66445.1| hypothetical protein VITISV_003574 [Vitis vinifera] Length = 1290 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/67 (40%), Positives = 40/67 (59%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQCEFAWRICNY 181 KVK F WLV HKK+N+ ++Q + K+L P C LC++ ES HIF+ C R+ Sbjct: 619 KVKSFVWLVAHKKVNTNDMLQVRRPYKALSPDICILCMKHGESADHIFLHCSLTIRL--- 675 Query: 182 WNSIEEL 202 W+ + +L Sbjct: 676 WHRLFQL 682 >emb|CAN65485.1| hypothetical protein VITISV_029475 [Vitis vinifera] Length = 875 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q K +K+L P C LC++ E+ H+F+ C Sbjct: 44 KVKSFVWLVAHKKVNTNDLLQLKRPHKALSPDICKLCMKHGETVDHLFLHC 94 >emb|CAN66166.1| hypothetical protein VITISV_000142 [Vitis vinifera] Length = 533 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/67 (38%), Positives = 40/67 (59%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQCEFAWRICNY 181 KVK F WLV HKK+N+ L+Q + +K+L P C LC++ E+ H+F+ C + Sbjct: 453 KVKSFVWLVAHKKLNTNDLLQLRRPHKALSPNICKLCMKHGETVDHLFLHCSLTKGL--- 509 Query: 182 WNSIEEL 202 WN + +L Sbjct: 510 WNRLFQL 516 >emb|CAN72506.1| hypothetical protein VITISV_027280 [Vitis vinifera] Length = 418 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK FGWLV HKK+N+ ++Q + K+L P C LC++ ES H+F+ C Sbjct: 301 KVKSFGWLVAHKKVNTNDMLQVRRPYKALSPDICILCMKHGESVDHLFLYC 351 >emb|CAN83427.1| hypothetical protein VITISV_009103 [Vitis vinifera] Length = 891 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K++ P C LC+++ ES H+F+ C Sbjct: 756 KVKAFIWLVAHKKVNTNDLLQLRRPHKAISPDICKLCMEQGESAYHLFLHC 806 >emb|CAN69984.1| hypothetical protein VITISV_028468 [Vitis vinifera] Length = 540 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ ++Q + K+L P C LC++ EST+H+F+ C Sbjct: 449 KVKSFVWLVAHKKVNTNDMLQVRRPYKALSPDICILCMKHGESTNHLFLHC 499 >emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] Length = 1070 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + K+L P C LC++ ES H+F++C Sbjct: 905 KVKSFIWLVAHKKVNTNDLLQLRRPYKTLSPNICKLCMKHGESADHLFLRC 955 >emb|CAN75028.1| hypothetical protein VITISV_026823 [Vitis vinifera] Length = 2182 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ ++Q + K+L P C LC++ EST H+F+ C Sbjct: 1685 KVKSFVWLVAHKKVNTNDMLQVRRPYKALSPNICILCMKHGESTDHLFLHC 1735 >emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] Length = 1306 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/51 (45%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K+L P C LC++ E+ H+F+ C Sbjct: 1146 KVKSFVWLVAHKKLNTNDLLQLRRPHKALSPNICKLCMKHGETVDHLFLHC 1196 >emb|CAN62051.1| hypothetical protein VITISV_016641 [Vitis vinifera] Length = 1866 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/51 (45%), Positives = 34/51 (66%) Frame = +2 Query: 2 KVKIFGWLVEHKKINSQYLVQRKNSNKSLLPQACPLCVQEKESTSHIFIQC 154 KVK F WLV HKK+N+ L+Q + +K+L P C LC++ E+ H+F+ C Sbjct: 1706 KVKSFVWLVAHKKLNTNDLLQLRRPHKALSPNICKLCMKHGETVDHLFLHC 1756