BLASTX nr result
ID: Sinomenium22_contig00058096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058096 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224752.1| hypothetical protein PRUPE_ppa024202mg [Prun... 45 6e-06 >ref|XP_007224752.1| hypothetical protein PRUPE_ppa024202mg [Prunus persica] gi|462421688|gb|EMJ25951.1| hypothetical protein PRUPE_ppa024202mg [Prunus persica] Length = 1106 Score = 44.7 bits (104), Expect(2) = 6e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -2 Query: 244 YWDIVG*DVCKACLHRLNNNGEVVDFNMTLIVLIP 140 YW IVG V ACL LN G V DFN TLI LIP Sbjct: 569 YWHIVGDSVSDACLRILNGEGSVRDFNHTLIALIP 603 Score = 30.8 bits (68), Expect(2) = 6e-06 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 327 KVEKALFQMY*LKSLDPNGFPALFYQ 250 ++E+AL QMY K+ NG PALFYQ Sbjct: 542 ELEQALGQMYPTKAPRINGMPALFYQ 567