BLASTX nr result
ID: Sinomenium22_contig00058059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00058059 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO... 73 1e-16 gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocer... 72 2e-16 gb|EME48945.1| hypothetical protein DOTSEDRAFT_67853 [Dothistrom... 73 3e-15 gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia ... 73 3e-15 ref|XP_002835429.1| 40S ribosomal protein S6 [Tuber melanosporum... 72 2e-13 ref|XP_003852989.1| 40S ribosomal protein S6 [Zymoseptoria triti... 68 3e-13 ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritic... 72 8e-13 gb|EMD69198.1| hypothetical protein COCSADRAFT_186166 [Bipolaris... 72 1e-12 ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres ... 72 1e-12 gb|ETI27818.1| 40S ribosomal protein S6-B [Cladophialophora carr... 70 1e-12 gb|EHY57703.1| 40S ribosomal protein S6-A [Exophiala dermatitidi... 70 1e-12 ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosp... 72 1e-12 gb|EXJ63909.1| 40S ribosomal protein S6-B [Cladophialophora yegr... 70 2e-12 ref|XP_003657816.1| 40S ribosomal protein S6 [Thielavia terrestr... 67 2e-12 ref|XP_003666960.1| hypothetical protein MYCTH_2312170 [Myceliop... 67 2e-12 gb|EQB52632.1| hypothetical protein CGLO_07726 [Colletotrichum g... 66 4e-12 gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris... 72 4e-12 gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolari... 72 4e-12 ref|XP_007279220.1| 40s ribosomal protein s6 [Colletotrichum glo... 66 4e-12 gb|EXJ72915.1| 40S ribosomal protein S6-B [Cladophialophora psam... 70 5e-12 >gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO2202] Length = 241 Score = 73.2 bits (178), Expect(2) = 1e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHR+ALKRR AEASKDAA Sbjct: 174 YTKAPRIQRLVTPQRLQHKRHRVALKRRRAEASKDAA 210 Score = 38.5 bits (88), Expect(2) = 1e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+LHKRV+EEKAKV D Sbjct: 211 NEYAQVLHKRVSEEKAKVAD 230 >gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocercospora fijiensis CIRAD86] Length = 241 Score = 72.4 bits (176), Expect(2) = 2e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHRIALKRR AEA+KDAA Sbjct: 174 YTKAPRIQRLVTPQRLQHKRHRIALKRRRAEAAKDAA 210 Score = 38.5 bits (88), Expect(2) = 2e-16 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+LHKRVAEEKAK D Sbjct: 211 NEYAQILHKRVAEEKAKAAD 230 >gb|EME48945.1| hypothetical protein DOTSEDRAFT_67853 [Dothistroma septosporum NZE10] Length = 241 Score = 73.2 bits (178), Expect(2) = 3e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHRIALKRR AEASKDAA Sbjct: 174 YTKAPRIQRLVTPQRLQHKRHRIALKRRHAEASKDAA 210 Score = 33.9 bits (76), Expect(2) = 3e-15 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 NEYAQ+LHKRV EEKAK Sbjct: 211 NEYAQVLHKRVNEEKAK 227 >gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia compniacensis UAMH 10762] Length = 239 Score = 72.8 bits (177), Expect(2) = 3e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHRIA+KRR AEASKDAA Sbjct: 172 YTKAPRIQRLVTPQRLQHKRHRIAIKRRRAEASKDAA 208 Score = 34.3 bits (77), Expect(2) = 3e-15 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+LHKRV EEK K D Sbjct: 209 NEYAQILHKRVGEEKQKQAD 228 >ref|XP_002835429.1| 40S ribosomal protein S6 [Tuber melanosporum Mel28] gi|295629210|emb|CAZ79586.1| unnamed protein product [Tuber melanosporum] Length = 214 Score = 72.4 bits (176), Expect(2) = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHRIALKRR AEASKDAA Sbjct: 141 YTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDAA 177 Score = 28.9 bits (63), Expect(2) = 2e-13 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 NEYA LL KRV EEKAK Sbjct: 178 NEYAALLAKRVHEEKAK 194 >ref|XP_003852989.1| 40S ribosomal protein S6 [Zymoseptoria tritici IPO323] gi|339472871|gb|EGP87965.1| hypothetical protein MYCGRDRAFT_104155 [Zymoseptoria tritici IPO323] Length = 241 Score = 67.8 bits (164), Expect(2) = 3e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHRIALKRR AE K+AA Sbjct: 174 YTKAPRIQRLVTPQRLQHKRHRIALKRRQAEKVKEAA 210 Score = 32.7 bits (73), Expect(2) = 3e-13 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 NEYAQ+LHKRV EEK+K Sbjct: 211 NEYAQVLHKRVNEEKSK 227 >ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983009|gb|EDU48497.1| 40S ribosomal protein S6-B [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 239 Score = 72.4 bits (176), Expect(2) = 8e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHRIALKRR AEASKDAA Sbjct: 172 YTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDAA 208 Score = 26.6 bits (57), Expect(2) = 8e-13 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKA 202 NEYAQ+L KR+ E KA Sbjct: 209 NEYAQILSKRINESKA 224 >gb|EMD69198.1| hypothetical protein COCSADRAFT_186166 [Bipolaris sorokiniana ND90Pr] Length = 263 Score = 71.6 bits (174), Expect(2) = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHR+ALKRR AEASKDAA Sbjct: 188 YTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDAA 224 Score = 26.9 bits (58), Expect(2) = 1e-12 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 252 QNEYAQLLHKRVAEEKA 202 QNEYAQ+L KR+ + KA Sbjct: 232 QNEYAQILSKRINDAKA 248 >ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres f. teres 0-1] gi|311315235|gb|EFQ84937.1| hypothetical protein PTT_20282 [Pyrenophora teres f. teres 0-1] Length = 239 Score = 72.0 bits (175), Expect(2) = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHR+ALKRR AEASKDAA Sbjct: 172 YTKAPKIQRLVTPQRLQHKRHRVALKRRRAEASKDAA 208 Score = 26.6 bits (57), Expect(2) = 1e-12 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKA 202 NEYAQ+L KR+ E KA Sbjct: 209 NEYAQILSKRINESKA 224 >gb|ETI27818.1| 40S ribosomal protein S6-B [Cladophialophora carrionii CBS 160.54] Length = 239 Score = 70.5 bits (171), Expect(2) = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQR+QHKRHRIALKRR AEA+KDAA Sbjct: 172 YTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAA 208 Score = 28.1 bits (61), Expect(2) = 1e-12 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 NEYAQLL KRV EE+ K Sbjct: 209 NEYAQLLAKRVHEEREK 225 >gb|EHY57703.1| 40S ribosomal protein S6-A [Exophiala dermatitidis NIH/UT8656] Length = 239 Score = 70.5 bits (171), Expect(2) = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQR+QHKRHRIALKRR AEA+KDAA Sbjct: 172 YTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAA 208 Score = 28.1 bits (61), Expect(2) = 1e-12 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 NEYAQLL KRV EE+ K Sbjct: 209 NEYAQLLAKRVHEEREK 225 >ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] gi|312213139|emb|CBX93221.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] Length = 313 Score = 72.0 bits (175), Expect(2) = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHR+ALKRR AEASKDAA Sbjct: 246 YTKAPKIQRLVTPQRLQHKRHRVALKRRRAEASKDAA 282 Score = 26.2 bits (56), Expect(2) = 1e-12 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKA 202 NEYAQ+L KR+++ KA Sbjct: 283 NEYAQILSKRISDAKA 298 >gb|EXJ63909.1| 40S ribosomal protein S6-B [Cladophialophora yegresii CBS 114405] Length = 239 Score = 70.5 bits (171), Expect(2) = 2e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQR+QHKRHRIALKRR AEA+KDAA Sbjct: 172 YTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAA 208 Score = 26.9 bits (58), Expect(2) = 2e-12 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 N+YAQLL KRV EE+ K Sbjct: 209 NDYAQLLAKRVHEEREK 225 >ref|XP_003657816.1| 40S ribosomal protein S6 [Thielavia terrestris NRRL 8126] gi|347005082|gb|AEO71480.1| hypothetical protein THITE_2171611 [Thielavia terrestris NRRL 8126] Length = 239 Score = 67.4 bits (163), Expect(2) = 2e-12 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHRIALKRR AE KD A Sbjct: 172 YTKAPRIQRLVTPQRLQHKRHRIALKRRQAEKVKDEA 208 Score = 30.0 bits (66), Expect(2) = 2e-12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+L KRVAE KA+ D Sbjct: 209 NEYAQILAKRVAEAKAQKAD 228 >ref|XP_003666960.1| hypothetical protein MYCTH_2312170 [Myceliophthora thermophila ATCC 42464] gi|347014233|gb|AEO61715.1| hypothetical protein MYCTH_2312170 [Myceliophthora thermophila ATCC 42464] Length = 238 Score = 67.4 bits (163), Expect(2) = 2e-12 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAPRIQRLVTPQRLQHKRHRIALKRR AE KD A Sbjct: 171 YTKAPRIQRLVTPQRLQHKRHRIALKRRQAEKVKDEA 207 Score = 30.0 bits (66), Expect(2) = 2e-12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+L KRVAE KA+ D Sbjct: 208 NEYAQILAKRVAEAKAQKAD 227 >gb|EQB52632.1| hypothetical protein CGLO_07726 [Colletotrichum gloeosporioides Cg-14] Length = 260 Score = 66.2 bits (160), Expect(2) = 4e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHRIALKRR AE KD A Sbjct: 193 YTKAPKIQRLVTPQRLQHKRHRIALKRRQAEKVKDEA 229 Score = 30.4 bits (67), Expect(2) = 4e-12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+L KRVAE KA+ D Sbjct: 230 NEYAQILAKRVAERKAEKAD 249 >gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris oryzae ATCC 44560] Length = 239 Score = 71.6 bits (174), Expect(2) = 4e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHR+ALKRR AEASKDAA Sbjct: 172 YTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDAA 208 Score = 25.0 bits (53), Expect(2) = 4e-12 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKA 202 NEYAQ+L KR+ + KA Sbjct: 209 NEYAQILSKRINDAKA 224 >gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolaris maydis C5] gi|477593859|gb|ENI10928.1| hypothetical protein COCC4DRAFT_46559 [Bipolaris maydis ATCC 48331] gi|576924864|gb|EUC38971.1| hypothetical protein COCCADRAFT_21712 [Bipolaris zeicola 26-R-13] gi|578485559|gb|EUN23053.1| hypothetical protein COCVIDRAFT_109868 [Bipolaris victoriae FI3] Length = 239 Score = 71.6 bits (174), Expect(2) = 4e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHR+ALKRR AEASKDAA Sbjct: 172 YTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDAA 208 Score = 25.0 bits (53), Expect(2) = 4e-12 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKA 202 NEYAQ+L KR+ + KA Sbjct: 209 NEYAQILSKRINDAKA 224 >ref|XP_007279220.1| 40s ribosomal protein s6 [Colletotrichum gloeosporioides Nara gc5] gi|429856799|gb|ELA31693.1| 40s ribosomal protein s6 [Colletotrichum gloeosporioides Nara gc5] Length = 208 Score = 66.2 bits (160), Expect(2) = 4e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQRLQHKRHRIALKRR AE KD A Sbjct: 141 YTKAPKIQRLVTPQRLQHKRHRIALKRRQAEKVKDEA 177 Score = 30.4 bits (67), Expect(2) = 4e-12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAKVQD 190 NEYAQ+L KRVAE KA+ D Sbjct: 178 NEYAQILAKRVAERKAEKAD 197 >gb|EXJ72915.1| 40S ribosomal protein S6-B [Cladophialophora psammophila CBS 110553] Length = 240 Score = 70.5 bits (171), Expect(2) = 5e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 410 YTKAPRIQRLVTPQRLQHKRHRIALKRRAAEASKDAA 300 YTKAP+IQRLVTPQR+QHKRHRIALKRR AEA+KDAA Sbjct: 172 YTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAA 208 Score = 25.8 bits (55), Expect(2) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 249 NEYAQLLHKRVAEEKAK 199 NEY QLL KRV EE+ K Sbjct: 209 NEYHQLLAKRVHEEREK 225