BLASTX nr result
ID: Sinomenium22_contig00057338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00057338 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME41891.1| hypothetical protein DOTSEDRAFT_46768 [Dothistrom... 55 8e-06 >gb|EME41891.1| hypothetical protein DOTSEDRAFT_46768 [Dothistroma septosporum NZE10] Length = 402 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = +1 Query: 10 RSHLQSWTKARWWTRLFTYLIHLQIQTAYHQILLSLWTISPSRM 141 R + ++A WWT LF YL+++ IQT Y +L++LWT+SPSRM Sbjct: 247 RQSSSTTSRASWWTTLFLYLMNINIQTCYRTLLVALWTLSPSRM 290