BLASTX nr result
ID: Sinomenium22_contig00057293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00057293 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] 60 3e-07 >gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] Length = 94 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/61 (40%), Positives = 41/61 (67%) Frame = +3 Query: 15 LWNLAVLSSMRFLWLERNSSVFEDKEAEPIVTWEKILYKISIWISLEEEFKKHLLSDILR 194 LW +A+++ +WLERN +FE +E + I+TW++I I++WI +EF L SD++R Sbjct: 30 LWKVAMMAIWWRIWLERNRRIFERREEDSIITWDRIKLNIALWIHSNKEFCDLLYSDLVR 89 Query: 195 D 197 D Sbjct: 90 D 90