BLASTX nr result
ID: Sinomenium22_contig00057190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00057190 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552902.1| PREDICTED: uncharacterized protein LOC100784... 55 8e-06 >ref|XP_003552902.1| PREDICTED: uncharacterized protein LOC100784357 isoform X1 [Glycine max] gi|571543201|ref|XP_006602045.1| PREDICTED: uncharacterized protein LOC100784357 isoform X2 [Glycine max] Length = 337 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/82 (43%), Positives = 46/82 (56%), Gaps = 9/82 (10%) Frame = -2 Query: 392 AAFAKVLDEAGVVLLFRDKVYLHPHKVCICYRSAAAFPFCFFLDTFEED----Q*EKANC 225 AAFA+VLDEAGVVLLFRDKVYLHP KV R A D E+ Q +K Sbjct: 151 AAFARVLDEAGVVLLFRDKVYLHPDKVVDLVRRAVPLALTADNDPMREELKKLQDKKEEI 210 Query: 224 NIL-----KEIVFVGSSFSLIS 174 ++L + I++ G F +I+ Sbjct: 211 DVLAHKQVRRILWSGLGFGVIT 232