BLASTX nr result
ID: Sinomenium22_contig00057134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00057134 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82685.1| hypothetical protein VITISV_000485 [Vitis vinifera] 44 5e-07 >emb|CAN82685.1| hypothetical protein VITISV_000485 [Vitis vinifera] Length = 1563 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = -1 Query: 181 KRKNHSLRVKKIWTVSALATVWLIWNERNALIFEDK 74 K +SLR K +W V+ L VW +W ERN IFEDK Sbjct: 1038 KGLGNSLRGKTLWQVACLTLVWXVWQERNNRIFEDK 1073 Score = 35.4 bits (80), Expect(2) = 5e-07 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 324 IPDRREWLHDKSSSYSCKSLFKFL--IGNPCTDIFHHALILWKSKVPLKVK 178 + D R W S +S KS F L + NP +F A LW SKVP KVK Sbjct: 956 LADSRAWSLSSSGLFSVKSFFLALSKVSNPI--LFLPAKFLWSSKVPSKVK 1004