BLASTX nr result
ID: Sinomenium22_contig00057133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00057133 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25339.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002320185.2| hypothetical protein POPTR_0014s09140g [Popu... 58 2e-06 ref|XP_006371310.1| hypothetical protein POPTR_0019s08960g [Popu... 57 2e-06 ref|XP_004308319.1| PREDICTED: uncharacterized protein LOC101299... 56 6e-06 emb|CBI40483.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_006491240.1| PREDICTED: uncharacterized protein At5g05190... 55 1e-05 ref|XP_006444880.1| hypothetical protein CICLE_v10018757mg [Citr... 55 1e-05 ref|XP_007011381.1| Uncharacterized protein TCM_045567 [Theobrom... 55 1e-05 ref|XP_004235450.1| PREDICTED: uncharacterized protein LOC101254... 55 1e-05 >emb|CBI25339.3| unnamed protein product [Vitis vinifera] Length = 1185 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/83 (36%), Positives = 46/83 (55%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEVLDDNPSLKDEPKHD 108 RLVRCPKCW +L E+A IP+Y+CG C L+AKN ++ S + ++E H Sbjct: 10 RLVRCPKCWKLLPEVAGIPLYQCGGCGVFLRAKNHGNSTKTTPSGSHETGSVQRNELVHV 69 Query: 107 FKIKDLDSSSEKSNLFSREACKM 39 + ++ SSS ++ S C + Sbjct: 70 SENEESSSSSREAIPSSTGECSL 92 >ref|XP_002320185.2| hypothetical protein POPTR_0014s09140g [Populus trichocarpa] gi|550323811|gb|EEE98500.2| hypothetical protein POPTR_0014s09140g [Populus trichocarpa] Length = 900 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEVLDD 141 RLVRCPKC +L ELAD +Y+CG C AVL+AKN N D ++ E D+ Sbjct: 8 RLVRCPKCENLLPELADYSVYQCGGCGAVLRAKNKNRDTDTLSLEKSDE 56 >ref|XP_006371310.1| hypothetical protein POPTR_0019s08960g [Populus trichocarpa] gi|550317062|gb|ERP49107.1| hypothetical protein POPTR_0019s08960g [Populus trichocarpa] Length = 1204 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/81 (35%), Positives = 43/81 (53%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEVLDDNPSLKDEPKHD 108 R VRCPKC +L+E DIP+YKCG C L+ K + E S + + + + K+ H Sbjct: 10 RFVRCPKCRQVLVEPQDIPVYKCGGCGTHLQVKIRKSNPEVATSGLHETDAAQKNRSDHI 69 Query: 107 FKIKDLDSSSEKSNLFSREAC 45 + K+ SS+ + N S C Sbjct: 70 SEAKESSSSNHEENFLSPGEC 90 >ref|XP_004308319.1| PREDICTED: uncharacterized protein LOC101299137 [Fragaria vesca subsp. vesca] Length = 921 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGES 165 RLVRCPKC +L ELAD +Y+CG C AVL+AK +DG++ Sbjct: 9 RLVRCPKCENLLPELADYSVYQCGGCGAVLRAKKKRQDGDT 49 >emb|CBI40483.3| unnamed protein product [Vitis vinifera] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/84 (36%), Positives = 43/84 (51%), Gaps = 10/84 (11%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEV----------LDDN 138 RLVRCPKC IL E D+P+Y CG C AVL+ K + G SE L+ Sbjct: 8 RLVRCPKCKHILPERPDVPVYLCGSCGAVLQGKKNRKSGVDTSSETSNEERVERVSLNSG 67 Query: 137 PSLKDEPKHDFKIKDLDSSSEKSN 66 L++E ++ + D+ + KSN Sbjct: 68 NLLENETENFNNLSDISDADVKSN 91 >ref|XP_006491240.1| PREDICTED: uncharacterized protein At5g05190-like [Citrus sinensis] Length = 915 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/74 (36%), Positives = 40/74 (54%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEVLDDNPSLKDEPKHD 108 RLVRCPKC +L EL D +Y+CG C AVL+AKN + ++ + ++ HD Sbjct: 8 RLVRCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEKSEEERVGEVSVKSHD 67 Query: 107 FKIKDLDSSSEKSN 66 K + S+ S+ Sbjct: 68 SPEKGIADLSDASD 81 >ref|XP_006444880.1| hypothetical protein CICLE_v10018757mg [Citrus clementina] gi|557547142|gb|ESR58120.1| hypothetical protein CICLE_v10018757mg [Citrus clementina] Length = 915 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/74 (36%), Positives = 40/74 (54%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEVLDDNPSLKDEPKHD 108 RLVRCPKC +L EL D +Y+CG C AVL+AKN + ++ + ++ HD Sbjct: 8 RLVRCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEKSEEERVGEVSVKSHD 67 Query: 107 FKIKDLDSSSEKSN 66 K + S+ S+ Sbjct: 68 SPEKGIADLSDASD 81 >ref|XP_007011381.1| Uncharacterized protein TCM_045567 [Theobroma cacao] gi|508728294|gb|EOY20191.1| Uncharacterized protein TCM_045567 [Theobroma cacao] Length = 1090 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKN 186 RLVRCPKC +L E+AD+P+YKCG C+A+L AKN Sbjct: 10 RLVRCPKCRLVLPEVADVPVYKCGGCDAILVAKN 43 >ref|XP_004235450.1| PREDICTED: uncharacterized protein LOC101254071 [Solanum lycopersicum] Length = 933 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -3 Query: 287 RLVRCPKCWGILLELADIPMYKCGECNAVLKAKNCNEDGESECSEVLDDN 138 R VRCPKC +L ELADIP+YKCG C +L+AKN + + +VLD N Sbjct: 10 RFVRCPKCQLVLPELADIPVYKCGGCGTILQAKNRKKAPIKK--DVLDQN 57