BLASTX nr result
ID: Sinomenium22_contig00056689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00056689 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051367.1| Pentatricopeptide repeat-containing protein,... 68 2e-09 ref|XP_002272556.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_006491416.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_006444679.1| hypothetical protein CICLE_v10023806mg [Citr... 66 4e-09 ref|XP_006289934.1| hypothetical protein CARUB_v10003556mg [Caps... 65 8e-09 gb|AAC62783.1| F11O4.7 [Arabidopsis thaliana] 65 8e-09 ref|NP_192066.2| pentatricopeptide repeat-containing protein [Ar... 65 8e-09 ref|XP_002874971.1| pentatricopeptide repeat-containing protein ... 65 8e-09 ref|XP_002302689.2| hypothetical protein POPTR_0002s18390g [Popu... 64 2e-08 ref|XP_006396354.1| hypothetical protein EUTSA_v10028437mg [Eutr... 64 3e-08 ref|XP_006386676.1| pentatricopeptide repeat-containing family p... 62 8e-08 ref|XP_002515124.1| pentatricopeptide repeat-containing protein,... 60 2e-07 gb|EYU39754.1| hypothetical protein MIMGU_mgv1a001778mg [Mimulus... 59 9e-07 ref|XP_004140525.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 >ref|XP_007051367.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508703628|gb|EOX95524.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 807 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/59 (59%), Positives = 50/59 (84%), Gaps = 1/59 (1%) Frame = +3 Query: 120 GRRTLSSALHGTPS-HLENLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNSI 293 G ++SS L +PS HL N+LL+AS++KTLS+SGTRNL+ +SIP+SE LV+QILR++S+ Sbjct: 7 GLSSVSSPLLKSPSIHLGNILLIASLTKTLSESGTRNLDPNSIPISEPLVIQILRKHSL 65 >ref|XP_002272556.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Vitis vinifera] Length = 792 Score = 67.8 bits (164), Expect = 2e-09 Identities = 37/61 (60%), Positives = 46/61 (75%) Frame = +3 Query: 111 MCHGRRTLSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNS 290 M HGR SSA G L ++LLVAS+SKTLS+ GTR+ + +SIP+SESLV+QIL RNS Sbjct: 1 MRHGRTLSSSAAAGAGVKLGDMLLVASISKTLSERGTRSPDLESIPISESLVVQILGRNS 60 Query: 291 I 293 I Sbjct: 61 I 61 >ref|XP_006491416.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Citrus sinensis] Length = 790 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +3 Query: 111 MCHGRRTLSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNS 290 M HGR+TLS ++ L ++LL+A V+KTL +SGTRNL+ SIP+SE LVLQ+L +NS Sbjct: 1 MRHGRKTLSPPVNSASLQLGSILLLAFVTKTLKESGTRNLDPRSIPISEPLVLQVLGKNS 60 Query: 291 I 293 + Sbjct: 61 L 61 >ref|XP_006444679.1| hypothetical protein CICLE_v10023806mg [Citrus clementina] gi|557546941|gb|ESR57919.1| hypothetical protein CICLE_v10023806mg [Citrus clementina] Length = 619 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +3 Query: 111 MCHGRRTLSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNS 290 M HGR+TLS ++ L ++LL+A V+KTL +SGTRNL+ SIP+SE LVLQ+L +NS Sbjct: 1 MRHGRKTLSPPVNSASLQLGSILLLAFVTKTLKESGTRNLDPRSIPISEPLVLQVLGKNS 60 Query: 291 I 293 + Sbjct: 61 L 61 >ref|XP_006289934.1| hypothetical protein CARUB_v10003556mg [Capsella rubella] gi|482558640|gb|EOA22832.1| hypothetical protein CARUB_v10003556mg [Capsella rubella] Length = 802 Score = 65.5 bits (158), Expect = 8e-09 Identities = 40/69 (57%), Positives = 50/69 (72%), Gaps = 8/69 (11%) Frame = +3 Query: 111 MCHGRRT--------LSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLV 266 M HGR + LS A + L N+LLVAS+SKTLS SGTR+L+A+SIP+SES+V Sbjct: 1 MRHGRGSAVSAAISGLSPAKNSPFPQLCNVLLVASLSKTLSQSGTRSLDANSIPISESVV 60 Query: 267 LQILRRNSI 293 LQILRR+SI Sbjct: 61 LQILRRSSI 69 >gb|AAC62783.1| F11O4.7 [Arabidopsis thaliana] Length = 508 Score = 65.5 bits (158), Expect = 8e-09 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 8/69 (11%) Frame = +3 Query: 111 MCHGRRT--------LSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLV 266 M HGR + LS A + L N+LLVAS+SKTLS SGTR+L+A+SIP+SE +V Sbjct: 1 MRHGRGSAVSAAISGLSPAKNSPFPQLCNVLLVASLSKTLSQSGTRSLDANSIPISEPVV 60 Query: 267 LQILRRNSI 293 LQILRRNSI Sbjct: 61 LQILRRNSI 69 >ref|NP_192066.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75161629|sp|Q8VZE4.1|PP299_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g01570 gi|18086402|gb|AAL57659.1| AT4g01570/T15B16_21 [Arabidopsis thaliana] gi|24797024|gb|AAN64524.1| At4g01570/T15B16_21 [Arabidopsis thaliana] gi|332656643|gb|AEE82043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 805 Score = 65.5 bits (158), Expect = 8e-09 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 8/69 (11%) Frame = +3 Query: 111 MCHGRRT--------LSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLV 266 M HGR + LS A + L N+LLVAS+SKTLS SGTR+L+A+SIP+SE +V Sbjct: 1 MRHGRGSAVSAAISGLSPAKNSPFPQLCNVLLVASLSKTLSQSGTRSLDANSIPISEPVV 60 Query: 267 LQILRRNSI 293 LQILRRNSI Sbjct: 61 LQILRRNSI 69 >ref|XP_002874971.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297320808|gb|EFH51230.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 802 Score = 65.5 bits (158), Expect = 8e-09 Identities = 40/69 (57%), Positives = 48/69 (69%), Gaps = 8/69 (11%) Frame = +3 Query: 111 MCHGRRT--------LSSALHGTPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLV 266 M HGR + LS A + L N+LLVAS+SKTLS SGTR L+A+SIP+SE +V Sbjct: 1 MRHGRGSAVSAAISGLSPATNSPFPQLCNVLLVASLSKTLSQSGTRGLDANSIPISEPVV 60 Query: 267 LQILRRNSI 293 LQILRRNSI Sbjct: 61 LQILRRNSI 69 >ref|XP_002302689.2| hypothetical protein POPTR_0002s18390g [Populus trichocarpa] gi|550345304|gb|EEE81962.2| hypothetical protein POPTR_0002s18390g [Populus trichocarpa] Length = 776 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 39/41 (95%) Frame = +3 Query: 171 NLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNSI 293 N+LLVA ++KTLS+SGTR+L+ DSIPLSESLVLQILRRNS+ Sbjct: 3 NILLVAYLTKTLSESGTRSLDPDSIPLSESLVLQILRRNSL 43 >ref|XP_006396354.1| hypothetical protein EUTSA_v10028437mg [Eutrema salsugineum] gi|557097371|gb|ESQ37807.1| hypothetical protein EUTSA_v10028437mg [Eutrema salsugineum] Length = 801 Score = 63.5 bits (153), Expect = 3e-08 Identities = 38/69 (55%), Positives = 53/69 (76%), Gaps = 8/69 (11%) Frame = +3 Query: 111 MCHGRRT-LSSALHG-TPSHLE------NLLLVASVSKTLSDSGTRNLEADSIPLSESLV 266 M HGR + +S+A+ G +P+ + N+L+VAS+SKTLS SGTRNL+A+S P+SE +V Sbjct: 1 MRHGRASAVSAAIAGLSPAKIPPFPQLCNVLVVASLSKTLSHSGTRNLDANSTPISEPIV 60 Query: 267 LQILRRNSI 293 LQILRRNS+ Sbjct: 61 LQILRRNSL 69 >ref|XP_006386676.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550345301|gb|ERP64473.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 776 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +3 Query: 171 NLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNSI 293 N+LLVA ++KTLS+SGTR+L+ DSIPLSE LVLQILRRNS+ Sbjct: 3 NILLVAYLTKTLSESGTRSLDPDSIPLSEYLVLQILRRNSL 43 >ref|XP_002515124.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545604|gb|EEF47108.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 898 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/58 (56%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = +3 Query: 123 RRTLSSALHGTPSH-LENLLLVASVSKTLSDSGTRNLEADSIPLSESLVLQILRRNSI 293 R +L S+L + S+ LE++LLVA ++K LS+SG RNL+ D IPLSE L+LQILR+NS+ Sbjct: 34 RFSLCSSLSSSSSNQLESILLVAFLNKALSESGVRNLDPDFIPLSEPLILQILRQNSL 91 >gb|EYU39754.1| hypothetical protein MIMGU_mgv1a001778mg [Mimulus guttatus] Length = 760 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/59 (52%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = +3 Query: 126 RTLSSALHGTPSHLENLLLVASVSKTLSDSG---TRNLEADSIPLSESLVLQILRRNSI 293 ++ + A+ GT S L NLL+VA+++KTLS+ G + +ADSIPLSE+LVLQ+LRR S+ Sbjct: 26 KSTNGAVSGTASELGNLLIVAAIAKTLSNPGGIHSLEKDADSIPLSENLVLQVLRRGSL 84 >ref|XP_004140525.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Cucumis sativus] gi|449523383|ref|XP_004168703.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Cucumis sativus] Length = 803 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 7/68 (10%) Frame = +3 Query: 111 MCHGR-RT--LSSALHG----TPSHLENLLLVASVSKTLSDSGTRNLEADSIPLSESLVL 269 M HGR RT LS H T SHL +LLL+AS++KTLS+SGTR L+ S+P+S L+L Sbjct: 1 MRHGRTRTCFLSIESHSRTASTLSHLSHLLLLASITKTLSESGTRTLQHHSLPISHPLLL 60 Query: 270 QILRRNSI 293 QIL S+ Sbjct: 61 QILHSRSL 68