BLASTX nr result
ID: Sinomenium22_contig00056589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00056589 (687 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO00295.1| hypothetical protein UCRPA7_4190 [Togninia minima... 94 5e-17 ref|XP_001905206.1| hypothetical protein [Podospora anserina S m... 91 3e-16 gb|EXK23944.1| hypothetical protein FOMG_19309 [Fusarium oxyspor... 69 1e-09 gb|EMR84743.1| hypothetical protein BcDW1_6599 [Botryotinia fuck... 68 2e-09 ref|XP_001550514.1| predicted protein [Botryotinia fuckeliana B0... 68 2e-09 >gb|EOO00295.1| hypothetical protein UCRPA7_4190 [Togninia minima UCRPA7] Length = 336 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/61 (68%), Positives = 49/61 (80%) Frame = -3 Query: 223 YDPCPKSCSISAGTVDLFYWPTRYPNVTYPATYVDTAIGYTFTSPSVYMLVNTMVGTNSA 44 YDPCP +CSISAGTV+L++WPT P +YP TYVDT +GYTF SPSVYM + T VGTNS Sbjct: 176 YDPCPTTCSISAGTVNLYFWPTDRP-YSYPTTYVDTNLGYTFVSPSVYMYIPTAVGTNSL 234 Query: 43 G 41 G Sbjct: 235 G 235 >ref|XP_001905206.1| hypothetical protein [Podospora anserina S mat+] gi|170939888|emb|CAP65114.1| unnamed protein product [Podospora anserina S mat+] Length = 520 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/64 (64%), Positives = 49/64 (76%) Frame = -3 Query: 223 YDPCPKSCSISAGTVDLFYWPTRYPNVTYPATYVDTAIGYTFTSPSVYMLVNTMVGTNSA 44 YDPCPKSCSISA +V L+YWPT P TYP TYVD ++ YTFTSPSVYM + + G N+ Sbjct: 196 YDPCPKSCSISAASVHLYYWPTDRP-YTYPTTYVDPSLSYTFTSPSVYMYIPSAQGVNTL 254 Query: 43 GQRV 32 G+RV Sbjct: 255 GERV 258 >gb|EXK23944.1| hypothetical protein FOMG_19309 [Fusarium oxysporum f. sp. melonis 26406] Length = 520 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/58 (58%), Positives = 39/58 (67%) Frame = -3 Query: 202 CSISAGTVDLFYWPTRYPNVTYPATYVDTAIGYTFTSPSVYMLVNTMVGTNSAGQRVP 29 CS+ GTVDL +WPT N +YP+TY DT YTFTSPSVYM+VNTM N G P Sbjct: 61 CSMYVGTVDLVFWPTT-GNHSYPSTYRDTISDYTFTSPSVYMIVNTMYAENPCGPLGP 117 >gb|EMR84743.1| hypothetical protein BcDW1_6599 [Botryotinia fuckeliana BcDW1] Length = 738 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 202 CSISAGTVDLFYWPTRYPNVTYPATYVDTAIGYTFTSPSVYMLVNTMVGTNSAGQRVP 29 C I AGTV Y+P N TYP+TY + AIG T TSPS+YM++NT+ G NS GQ P Sbjct: 99 CHIFAGTVQFSYFPQASGNTTYPSTYYNEAIGITMTSPSMYMVINTLSGYNSCGQVGP 156 >ref|XP_001550514.1| predicted protein [Botryotinia fuckeliana B05.10] gi|347832988|emb|CCD48685.1| hypothetical protein BofuT4_P033270.1 [Botryotinia fuckeliana T4] Length = 734 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 202 CSISAGTVDLFYWPTRYPNVTYPATYVDTAIGYTFTSPSVYMLVNTMVGTNSAGQRVP 29 C I AGTV Y+P N TYP+TY + AIG T TSPS+YM++NT+ G NS GQ P Sbjct: 99 CHIFAGTVQFSYFPQASGNTTYPSTYYNEAIGITMTSPSMYMVINTLSGYNSCGQVGP 156