BLASTX nr result
ID: Sinomenium22_contig00056401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00056401 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON96393.1| putative thioredoxin protein [Togninia minima UCR... 113 2e-23 gb|AAX07630.1| thioredoxin-like protein [Magnaporthe grisea] gi|... 113 2e-23 ref|XP_003719578.1| thioredoxin [Magnaporthe oryzae 70-15] gi|35... 113 2e-23 ref|XP_003666067.1| hypothetical protein MYCTH_2310462 [Myceliop... 110 3e-22 gb|EJT77924.1| thioredoxin [Gaeumannomyces graminis var. tritici... 108 1e-21 gb|ABC75102.1| thioredoxin [Cryphonectria parasitica] 106 4e-21 gb|ETS83579.1| hypothetical protein PFICI_05455 [Pestalotiopsis ... 102 6e-20 gb|EQL32753.1| hypothetical protein BDFG_05140 [Ajellomyces derm... 102 6e-20 gb|EGE82341.1| thioredoxin [Ajellomyces dermatitidis ATCC 18188] 102 6e-20 gb|EEQ88942.1| thioredoxin [Ajellomyces dermatitidis ER-3] 102 6e-20 ref|XP_002628145.1| thioredoxin [Ajellomyces dermatitidis SLH140... 102 6e-20 gb|EGY19582.1| thioredoxin [Verticillium dahliae VdLs.17] 102 7e-20 gb|EHK98740.1| putative Thioredoxin [Glarea lozoyensis 74030] gi... 101 9e-20 ref|XP_003005517.1| thioredoxin [Verticillium alfalfae VaMs.102]... 101 1e-19 ref|XP_003652652.1| hypothetical protein THITE_2170264 [Thielavi... 100 2e-19 gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] 99 5e-19 gb|EMR62195.1| putative thioredoxin protein [Eutypa lata UCREL1] 99 6e-19 ref|XP_006694128.1| hypothetical protein CTHT_0037020 [Chaetomiu... 99 6e-19 gb|EEH22651.1| thioredoxin [Paracoccidioides brasiliensis Pb03] ... 99 6e-19 ref|XP_002795658.1| thioredoxin [Paracoccidioides sp. 'lutzii' P... 99 6e-19 >gb|EON96393.1| putative thioredoxin protein [Togninia minima UCRPA7] Length = 115 Score = 113 bits (283), Expect = 2e-23 Identities = 48/84 (57%), Positives = 64/84 (76%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPCKAIAP+++ W+ + IH+ KVDVD LP L+QEYG+ AMPTFM+FK+G+KVD Sbjct: 27 FATWCGPCKAIAPKISQWALENPSIHFAKVDVDDLPELSQEYGIRAMPTFMIFKNGDKVD 86 Query: 182 SLRGAMPQALLKIIENHNPADETK 253 GA P LL++I H P ++ + Sbjct: 87 EFVGANPGPLLQLISKHKPEEKAE 110 >gb|AAX07630.1| thioredoxin-like protein [Magnaporthe grisea] gi|440469350|gb|ELQ38465.1| thioredoxin [Magnaporthe oryzae Y34] gi|440484785|gb|ELQ64808.1| thioredoxin [Magnaporthe oryzae P131] Length = 107 Score = 113 bits (283), Expect = 2e-23 Identities = 49/80 (61%), Positives = 63/80 (78%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPC+AIAP++A+WS+ + IHYVKVDVD +P + QEY V AMPTF+LFKDGEKVD Sbjct: 27 FATWCGPCRAIAPKIAEWSDAFPNIHYVKVDVDEVPDVAQEYNVRAMPTFLLFKDGEKVD 86 Query: 182 SLRGAMPQALLKIIENHNPA 241 + GA P L +I ++P+ Sbjct: 87 EVVGANPPKLQALISANHPS 106 >ref|XP_003719578.1| thioredoxin [Magnaporthe oryzae 70-15] gi|351639347|gb|EHA47211.1| thioredoxin [Magnaporthe oryzae 70-15] Length = 171 Score = 113 bits (283), Expect = 2e-23 Identities = 49/80 (61%), Positives = 63/80 (78%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPC+AIAP++A+WS+ + IHYVKVDVD +P + QEY V AMPTF+LFKDGEKVD Sbjct: 91 FATWCGPCRAIAPKIAEWSDAFPNIHYVKVDVDEVPDVAQEYNVRAMPTFLLFKDGEKVD 150 Query: 182 SLRGAMPQALLKIIENHNPA 241 + GA P L +I ++P+ Sbjct: 151 EVVGANPPKLQALISANHPS 170 >ref|XP_003666067.1| hypothetical protein MYCTH_2310462 [Myceliophthora thermophila ATCC 42464] gi|347013339|gb|AEO60822.1| hypothetical protein MYCTH_2310462 [Myceliophthora thermophila ATCC 42464] Length = 123 Score = 110 bits (274), Expect = 3e-22 Identities = 53/92 (57%), Positives = 64/92 (69%), Gaps = 8/92 (8%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNK---YTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGE 172 FATWCGPCKAIAPQ+A WS I++ K DVD LP L QE G+ AMPTF++FKDGE Sbjct: 27 FATWCGPCKAIAPQIAKWSEDPEFSDSIYFAKFDVDQLPDLAQELGIRAMPTFLVFKDGE 86 Query: 173 KVDSLRGAMPQALLKIIENHNP-----ADETK 253 K DS GA+P LL +I+ HNP AD+T+ Sbjct: 87 KADSFTGAVPPQLLNLIKKHNPKSSEAADKTE 118 >gb|EJT77924.1| thioredoxin [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 172 Score = 108 bits (269), Expect = 1e-21 Identities = 45/74 (60%), Positives = 59/74 (79%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPC+ I+P+V++WS K+ IHYVKVDVD +P ++QEYG+ AMPTF+LFKDGEK D Sbjct: 92 YATWCGPCRMISPKVSEWSEKFPNIHYVKVDVDTVPDVSQEYGIRAMPTFLLFKDGEKAD 151 Query: 182 SLRGAMPQALLKII 223 + GA P L +I Sbjct: 152 EVVGANPPKLEALI 165 >gb|ABC75102.1| thioredoxin [Cryphonectria parasitica] Length = 117 Score = 106 bits (264), Expect = 4e-21 Identities = 46/81 (56%), Positives = 60/81 (74%), Gaps = 2/81 (2%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGE--K 175 FATWCGPCK IAP++A+WSN+YTG+++VK+DVDALP L E+ V AMPTF +FKDG Sbjct: 27 FATWCGPCKMIAPKIAEWSNEYTGVYFVKIDVDALPELAAEHNVKAMPTFHVFKDGNTTA 86 Query: 176 VDSLRGAMPQALLKIIENHNP 238 + A+P + +IE HNP Sbjct: 87 AEEFVSAVPPKVQALIEKHNP 107 >gb|ETS83579.1| hypothetical protein PFICI_05455 [Pestalotiopsis fici W106-1] Length = 106 Score = 102 bits (254), Expect = 6e-20 Identities = 48/77 (62%), Positives = 59/77 (76%), Gaps = 2/77 (2%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSN--KYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEK 175 FATWCGPCKAIAP +A+ SN KY + + K+DVD LP L+QE G+ AMPTFMLFKDGEK Sbjct: 27 FATWCGPCKAIAPILANHSNDEKYKDVFFAKIDVDDLPELSQELGIRAMPTFMLFKDGEK 86 Query: 176 VDSLRGAMPQALLKIIE 226 D L GA P AL+ +++ Sbjct: 87 ADELVGANPNALVTLLD 103 >gb|EQL32753.1| hypothetical protein BDFG_05140 [Ajellomyces dermatitidis ATCC 26199] Length = 231 Score = 102 bits (254), Expect = 6e-20 Identities = 44/77 (57%), Positives = 57/77 (74%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPCKAIAP++ ++S+ Y + + KVDVD P + QE GV AMPTF+ FKDG+KVD Sbjct: 152 YATWCGPCKAIAPKLVEFSDTYPNVGFYKVDVDECPDIAQELGVRAMPTFIFFKDGQKVD 211 Query: 182 SLRGAMPQALLKIIENH 232 + GAMP A+L I H Sbjct: 212 EVLGAMPAAILAAINKH 228 >gb|EGE82341.1| thioredoxin [Ajellomyces dermatitidis ATCC 18188] Length = 229 Score = 102 bits (254), Expect = 6e-20 Identities = 44/77 (57%), Positives = 57/77 (74%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPCKAIAP++ ++S+ Y + + KVDVD P + QE GV AMPTF+ FKDG+KVD Sbjct: 150 YATWCGPCKAIAPKLVEFSDTYPNVGFYKVDVDECPDIAQELGVRAMPTFIFFKDGQKVD 209 Query: 182 SLRGAMPQALLKIIENH 232 + GAMP A+L I H Sbjct: 210 EVLGAMPAAILAAINKH 226 >gb|EEQ88942.1| thioredoxin [Ajellomyces dermatitidis ER-3] Length = 119 Score = 102 bits (254), Expect = 6e-20 Identities = 44/77 (57%), Positives = 57/77 (74%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPCKAIAP++ ++S+ Y + + KVDVD P + QE GV AMPTF+ FKDG+KVD Sbjct: 40 YATWCGPCKAIAPKLVEFSDTYPNVGFYKVDVDECPDIAQELGVRAMPTFIFFKDGQKVD 99 Query: 182 SLRGAMPQALLKIIENH 232 + GAMP A+L I H Sbjct: 100 EVLGAMPAAILAAINKH 116 >ref|XP_002628145.1| thioredoxin [Ajellomyces dermatitidis SLH14081] gi|239590242|gb|EEQ72823.1| thioredoxin [Ajellomyces dermatitidis SLH14081] Length = 234 Score = 102 bits (254), Expect = 6e-20 Identities = 44/77 (57%), Positives = 57/77 (74%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPCKAIAP++ ++S+ Y + + KVDVD P + QE GV AMPTF+ FKDG+KVD Sbjct: 155 YATWCGPCKAIAPKLVEFSDTYPNVGFYKVDVDECPDIAQELGVRAMPTFIFFKDGQKVD 214 Query: 182 SLRGAMPQALLKIIENH 232 + GAMP A+L I H Sbjct: 215 EVLGAMPAAILAAINKH 231 >gb|EGY19582.1| thioredoxin [Verticillium dahliae VdLs.17] Length = 118 Score = 102 bits (253), Expect = 7e-20 Identities = 45/74 (60%), Positives = 57/74 (77%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPCK IAP A S KYT ++++K+DVD +P L+QE G+ AMPTFM+FKDGEKV+ Sbjct: 40 FATWCGPCKTIAPIYAQLSEKYTSVNFLKIDVDEVPDLSQELGIRAMPTFMVFKDGEKVE 99 Query: 182 SLRGAMPQALLKII 223 + GA P AL K + Sbjct: 100 EIVGANPPALEKAL 113 >gb|EHK98740.1| putative Thioredoxin [Glarea lozoyensis 74030] gi|512199513|gb|EPE28346.1| Thioredoxin-like protein [Glarea lozoyensis ATCC 20868] Length = 106 Score = 101 bits (252), Expect = 9e-20 Identities = 44/75 (58%), Positives = 57/75 (76%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPCK IAP V +S+++ IH+VK+DVD +P + QE G+ AMPTF++FKDGEKV Sbjct: 27 FATWCGPCKVIAPTVVKFSDEFPSIHFVKIDVDEVPDVAQELGIRAMPTFLIFKDGEKVQ 86 Query: 182 SLRGAMPQALLKIIE 226 + GA PQAL I+ Sbjct: 87 EVVGANPQALKAAID 101 >ref|XP_003005517.1| thioredoxin [Verticillium alfalfae VaMs.102] gi|261354933|gb|EEY17361.1| thioredoxin [Verticillium alfalfae VaMs.102] Length = 118 Score = 101 bits (251), Expect = 1e-19 Identities = 44/74 (59%), Positives = 57/74 (77%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPCK IAP A S KYT ++++K+DVD +P L+QE G+ AMPTFM+FKDG+KV+ Sbjct: 40 FATWCGPCKTIAPVYAQLSEKYTSVNFLKIDVDEVPDLSQELGIRAMPTFMVFKDGQKVE 99 Query: 182 SLRGAMPQALLKII 223 + GA P AL K + Sbjct: 100 EIVGANPPALEKAL 113 >ref|XP_003652652.1| hypothetical protein THITE_2170264 [Thielavia terrestris NRRL 8126] gi|346999914|gb|AEO66316.1| hypothetical protein THITE_2170264 [Thielavia terrestris NRRL 8126] Length = 134 Score = 100 bits (249), Expect = 2e-19 Identities = 46/84 (54%), Positives = 59/84 (70%), Gaps = 3/84 (3%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYT---GIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGE 172 FATWCGPCKAIAPQVA W+ ++ K DVD +P L QE G+ AMPTF++FKDG+ Sbjct: 27 FATWCGPCKAIAPQVARWAEDPAFKDKTYFAKFDVDEVPDLAQELGIRAMPTFLVFKDGQ 86 Query: 173 KVDSLRGAMPQALLKIIENHNPAD 244 KVD L GA P ALL +++ + P + Sbjct: 87 KVDDLLGANPPALLNLLKKYTPEE 110 >gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] Length = 107 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/77 (58%), Positives = 54/77 (70%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 FATWCGPCK IAPQV +S Y + K+DVD +P + QE G+ AMPTF+LFK GEKVD Sbjct: 27 FATWCGPCKVIAPQVVKFSEAYPNAKFYKLDVDEVPDVAQELGIRAMPTFLLFKGGEKVD 86 Query: 182 SLRGAMPQALLKIIENH 232 + GA P+AL IE H Sbjct: 87 EVVGANPKALQAAIEKH 103 >gb|EMR62195.1| putative thioredoxin protein [Eutypa lata UCREL1] Length = 106 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/79 (58%), Positives = 59/79 (74%), Gaps = 2/79 (2%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSN--KYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEK 175 FATWCGPCKAIAP +A SN ++ I + K+DVD LP L+QE G+ AMPTFM+FKDGEK Sbjct: 27 FATWCGPCKAIAPILAKHSNDEQFKDIFFAKIDVDDLPELSQELGIRAMPTFMIFKDGEK 86 Query: 176 VDSLRGAMPQALLKIIENH 232 D L GA P LL++++ + Sbjct: 87 ADELVGANPNVLLQLLQKN 105 >ref|XP_006694128.1| hypothetical protein CTHT_0037020 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340960651|gb|EGS21832.1| hypothetical protein CTHT_0037020 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 109 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/80 (57%), Positives = 58/80 (72%), Gaps = 3/80 (3%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYT---GIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGE 172 FA WCGPCKAIAP +A WS I++VK DVDA+P L QE G+ +MPTF++FKDGE Sbjct: 27 FAEWCGPCKAIAPALARWSEDPAYKDKIYFVKFDVDAVPDLAQELGIRSMPTFIIFKDGE 86 Query: 173 KVDSLRGAMPQALLKIIENH 232 KVD + GA PQALL ++ + Sbjct: 87 KVDEMVGAQPQALLGLLNRY 106 >gb|EEH22651.1| thioredoxin [Paracoccidioides brasiliensis Pb03] gi|226294005|gb|EEH49425.1| thioredoxin [Paracoccidioides brasiliensis Pb18] Length = 117 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/77 (54%), Positives = 56/77 (72%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPCK IAP++ ++S Y + + KVDVD P + QE GV AMPTF+ FKDG+KVD Sbjct: 39 YATWCGPCKMIAPKLVEFSESYPNVAFYKVDVDECPDIAQELGVRAMPTFIFFKDGQKVD 98 Query: 182 SLRGAMPQALLKIIENH 232 + GA+PQA+ I+ H Sbjct: 99 EVMGAVPQAVEAAIKKH 115 >ref|XP_002795658.1| thioredoxin [Paracoccidioides sp. 'lutzii' Pb01] gi|34980254|gb|AAQ84040.1| thioredoxin [Paracoccidioides brasiliensis] gi|226284743|gb|EEH40309.1| thioredoxin [Paracoccidioides sp. 'lutzii' Pb01] Length = 116 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/77 (54%), Positives = 56/77 (72%) Frame = +2 Query: 2 FATWCGPCKAIAPQVADWSNKYTGIHYVKVDVDALPSLTQEYGVTAMPTFMLFKDGEKVD 181 +ATWCGPCK IAP++ ++S Y + + KVDVD P + QE GV AMPTF+ FKDG+KVD Sbjct: 38 YATWCGPCKVIAPKLVEFSETYPNVTFYKVDVDECPDIAQELGVRAMPTFIFFKDGQKVD 97 Query: 182 SLRGAMPQALLKIIENH 232 + GA+PQA+ I+ H Sbjct: 98 EVMGAVPQAVEAAIKKH 114