BLASTX nr result
ID: Sinomenium22_contig00056019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00056019 (766 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis ... 86 1e-14 gb|ABQ14933.1| Ycf2 [Saxifraga stolonifera] 85 3e-14 gb|AEZ48753.1| hypothetical chloroplast RF2, partial [Sparganium... 84 7e-14 ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica... 84 7e-14 ref|YP_001123242.1| hypothetical protein ArhiCp064 [Arabis hirsu... 83 9e-14 ref|YP_053198.1| Ycf2 [Nymphaea alba] gi|50346848|ref|YP_053219.... 83 1e-13 gb|ADD30889.1| putative RF2 protein [Ximenia americana] gi|34080... 83 1e-13 ref|XP_006850224.1| hypothetical protein AMTR_s00543p00008950 [A... 82 2e-13 gb|ADD30893.1| putative RF2 protein [Ficus sp. Moore 315] gi|340... 82 2e-13 ref|YP_003434019.1| hypothetical chloroplast RF21 [Typha latifol... 82 2e-13 ref|YP_762304.1| hypothetical chloroplast RF2 [Morus indica] gi|... 82 2e-13 ref|YP_009019931.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_008993735.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_009000376.1| hypothetical protein BN845_0850 (chloroplast... 82 2e-13 ref|YP_008993907.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 ref|YP_008963735.1| hypothetical chloroplast RF21 (chloroplast) ... 82 2e-13 >ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|229577815|ref|YP_002836151.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933926|gb|ACO92059.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933943|gb|ACO92076.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] Length = 2288 Score = 86.3 bits (212), Expect = 1e-14 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADLLTLSITEPDL YHKGFAFSIDSYRLD Sbjct: 607 YTLHHDFESEERFQEMADLLTLSITEPDLVYHKGFAFSIDSYRLD 651 >gb|ABQ14933.1| Ycf2 [Saxifraga stolonifera] Length = 2274 Score = 84.7 bits (208), Expect = 3e-14 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSYRLD Sbjct: 604 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYRLD 648 >gb|AEZ48753.1| hypothetical chloroplast RF2, partial [Sparganium eurycarpum] Length = 2260 Score = 83.6 bits (205), Expect = 7e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YH+GFAFSIDSYRLD Sbjct: 598 YTLHHDFESEERFQEMADLFTLSITEPDLVYHRGFAFSIDSYRLD 642 >ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114330032|ref|YP_740713.1| hypothetical chloroplast RF2 [Nandina domestica] gi|122165906|sp|Q09FP8.1|YCF2_NANDO RecName: Full=Protein Ycf2 gi|114054515|gb|ABI49908.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114054534|gb|ABI49927.1| hypothetical chloroplast RF2 [Nandina domestica] Length = 2299 Score = 83.6 bits (205), Expect = 7e-14 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADLLTLSITEPDL YHKGFAFSIDSY LD Sbjct: 604 YTLHHDFESEERFQEMADLLTLSITEPDLVYHKGFAFSIDSYGLD 648 >ref|YP_001123242.1| hypothetical protein ArhiCp064 [Arabis hirsuta] gi|139389706|ref|YP_001123262.1| hypothetical protein ArhiCp084 [Arabis hirsuta] gi|205412799|sp|A4QK61.1|YCF2_ARAHI RecName: Full=Protein Ycf2 gi|134286440|dbj|BAF50066.1| hypothetical protein [Arabis hirsuta] gi|134286461|dbj|BAF50087.1| hypothetical protein [Arabis hirsuta] Length = 2296 Score = 83.2 bits (204), Expect = 9e-14 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFEAEERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 602 YTLRHDFEAEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 646 >ref|YP_053198.1| Ycf2 [Nymphaea alba] gi|50346848|ref|YP_053219.1| Ycf2 [Nymphaea alba] gi|68053155|sp|Q6EVY7.1|YCF2_NYMAL RecName: Full=Protein Ycf2 gi|50250372|emb|CAF28638.1| ycf2 [Nymphaea alba] gi|50250393|emb|CAF28659.1| ycf2 [Nymphaea alba] Length = 2253 Score = 82.8 bits (203), Expect = 1e-13 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 346 KYTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 +YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 602 RYTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 647 >gb|ADD30889.1| putative RF2 protein [Ximenia americana] gi|340807071|gb|AEK71677.1| hypothetical chloroplast RF2 [Ximenia americana] Length = 2285 Score = 82.8 bits (203), Expect = 1e-13 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 346 KYTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 +YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 601 RYTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 646 >ref|XP_006850224.1| hypothetical protein AMTR_s00543p00008950 [Amborella trichopoda] gi|548853828|gb|ERN11805.1| hypothetical protein AMTR_s00543p00008950 [Amborella trichopoda] Length = 2100 Score = 82.4 bits (202), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFA SIDSYRLD Sbjct: 432 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFALSIDSYRLD 476 >gb|ADD30893.1| putative RF2 protein [Ficus sp. Moore 315] gi|340807156|gb|AEK71751.1| hypothetical chloroplast RF2 [Ficus sp. M. J. Moore 315] Length = 2289 Score = 82.4 bits (202), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFA SIDSYRLD Sbjct: 606 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFALSIDSYRLD 650 >ref|YP_003434019.1| hypothetical chloroplast RF21 [Typha latifolia] gi|289065151|ref|YP_003434036.1| hypothetical chloroplast RF21 [Typha latifolia] gi|281371816|gb|ADA63743.1| hypothetical chloroplast RF21 [Typha latifolia] gi|281371834|gb|ADA63761.1| hypothetical chloroplast RF21 [Typha latifolia] Length = 2293 Score = 82.4 bits (202), Expect = 2e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YH+GF+FSIDSYRLD Sbjct: 599 YTLHHDFESEERFQEMADLFTLSITEPDLVYHRGFSFSIDSYRLD 643 >ref|YP_762304.1| hypothetical chloroplast RF2 [Morus indica] gi|114804324|ref|YP_762321.1| hypothetical chloroplast RF2 [Morus indica] gi|122166751|sp|Q09WV7.1|YCF2_MORIN RecName: Full=Protein Ycf2 gi|78100359|gb|ABB21000.1| hypothetical chloroplast RF2 [Morus indica] gi|78100376|gb|ABB21017.1| hypothetical chloroplast RF2 [Morus indica] Length = 2292 Score = 82.4 bits (202), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFA SIDSYRLD Sbjct: 606 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFALSIDSYRLD 650 >ref|YP_009019931.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] gi|595789742|ref|YP_009019949.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] gi|586947578|gb|AHJ91361.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] gi|586947597|gb|AHJ91380.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] Length = 2275 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 602 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 646 >ref|YP_008993735.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia salicifolia] gi|573972436|ref|YP_008993754.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia salicifolia] Length = 2298 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 607 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 651 >ref|YP_009000376.1| hypothetical protein BN845_0850 (chloroplast) [Arabis alpina] gi|575771070|ref|YP_009000396.1| hypothetical protein BN845_1270 (chloroplast) [Arabis alpina] gi|571025848|emb|CCW28223.1| hypothetical protein BN845_0850 (chloroplast) [Arabis alpina] gi|571025868|emb|CCW28243.1| hypothetical protein BN845_1270 (chloroplast) [Arabis alpina] Length = 2292 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 606 YTLRHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 650 >ref|YP_008993907.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sprengeri] gi|570772356|ref|YP_008993926.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sprengeri] Length = 2298 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 607 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 651 >ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] gi|570772258|ref|YP_008993840.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] Length = 2298 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 607 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 651 >ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] gi|570760248|ref|YP_008993668.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] Length = 2298 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 607 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 651 >ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] gi|570759987|ref|YP_008993410.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] Length = 2298 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 607 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 651 >ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] gi|570759813|ref|YP_008993238.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] Length = 2298 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 607 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 651 >ref|YP_008963735.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|568244972|ref|YP_008963754.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|491650414|gb|AGL13474.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|491650433|gb|AGL13493.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] Length = 2297 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 343 YTLCHDFEAEERFQEIADLLTLSITEPDLGYHKGFAFSIDSYRLD 209 YTL HDFE+EERFQE+ADL TLSITEPDL YHKGFAFSIDSY LD Sbjct: 602 YTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFAFSIDSYGLD 646