BLASTX nr result
ID: Sinomenium22_contig00055369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00055369 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] 52 3e-06 >gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] Length = 562 Score = 52.0 bits (123), Expect(3) = 3e-06 Identities = 22/41 (53%), Positives = 32/41 (78%) Frame = +3 Query: 99 MINKILSTERMPDEWRKNILISIYKHKMNISSCENYQIYKL 221 + N+IL +++MP EWRK+ L+ IYK+K +I SCENY+ KL Sbjct: 96 LFNEILRSKKMPGEWRKSTLVPIYKNKGDIQSCENYRGIKL 136 Score = 22.3 bits (46), Expect(3) = 3e-06 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 5 KTLLR*IKNAKTL*PNGIPIEVY 73 K L +KN + + P+ IPIEV+ Sbjct: 60 KEALNQMKNDRAVGPDNIPIEVW 82 Score = 21.2 bits (43), Expect(3) = 3e-06 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 227 LKLWDKVIENQVLAEIMV 280 +KLW++VIE + E V Sbjct: 141 MKLWERVIERGLRKETQV 158