BLASTX nr result
ID: Sinomenium22_contig00055355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00055355 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207760.1| hypothetical protein PRUPE_ppa026822mg [Prun... 56 6e-06 >ref|XP_007207760.1| hypothetical protein PRUPE_ppa026822mg [Prunus persica] gi|462403402|gb|EMJ08959.1| hypothetical protein PRUPE_ppa026822mg [Prunus persica] Length = 228 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 273 LVVHPGFNSELAMAFVIIMDRICRKPFTPILCS 175 LVV PGF+ +L M FVII+DRIC KPFTPILCS Sbjct: 196 LVVQPGFDLDLIMGFVIILDRICGKPFTPILCS 228