BLASTX nr result
ID: Sinomenium22_contig00055152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00055152 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB82639.1| putative non-LTR retroelement reverse transcripta... 59 7e-07 ref|XP_004306191.1| PREDICTED: putative ribonuclease H protein A... 57 2e-06 ref|XP_007210987.1| hypothetical protein PRUPE_ppa021345mg [Prun... 56 6e-06 ref|XP_007199601.1| hypothetical protein PRUPE_ppa023095mg, part... 56 6e-06 >gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1374 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +2 Query: 335 DKIEKGVLGGEENLLSTAGKEVLLKTVALSMPIFLMSGFKFPTTVCLSISSKLA 496 D++ K VLG + N LS GKE+LLK VA+++P + MS FK P T+C I S +A Sbjct: 770 DRLGKKVLGWQSNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTICQQIESVMA 823 >ref|XP_004306191.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria vesca subsp. vesca] Length = 755 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = +2 Query: 335 DKIEKGVLGGEENLLSTAGKEVLLKTVALSMPIFLMSGFKFPTTVCLSISSKLA 496 D I K + G ++ +LS AGKE+L+K VA S+PI+ M+ FKFP T+C I+S LA Sbjct: 242 DTILKKIQGWKQGILSPAGKEILIKAVAASIPIYPMACFKFPKTLCNQINSALA 295 >ref|XP_007210987.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica] gi|462406722|gb|EMJ12186.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica] Length = 759 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/54 (50%), Positives = 40/54 (74%) Frame = +2 Query: 335 DKIEKGVLGGEENLLSTAGKEVLLKTVALSMPIFLMSGFKFPTTVCLSISSKLA 496 D+I + V G ++ LS AG+E+L+K+VAL++P + M+ FKFPTT+C I S LA Sbjct: 164 DRILRKVHGWNQHCLSQAGREILIKSVALAVPAYPMNIFKFPTTLCKEIDSVLA 217 >ref|XP_007199601.1| hypothetical protein PRUPE_ppa023095mg, partial [Prunus persica] gi|462395001|gb|EMJ00800.1| hypothetical protein PRUPE_ppa023095mg, partial [Prunus persica] Length = 933 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/54 (50%), Positives = 40/54 (74%) Frame = +2 Query: 335 DKIEKGVLGGEENLLSTAGKEVLLKTVALSMPIFLMSGFKFPTTVCLSISSKLA 496 D+I + V G ++ LS AG+E+L+K+VAL++P + M+ FKFPTT+C I S LA Sbjct: 352 DRILRKVHGWNQHCLSQAGREILIKSVALAVPAYPMNIFKFPTTLCKEIDSVLA 405