BLASTX nr result
ID: Sinomenium22_contig00055148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00055148 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 60 3e-07 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = -1 Query: 285 GIVNMTDFIKNMKLVLYISPQCCFLCKQDEESVNHLFLHCEFTIRIW 145 G VN +D ++ + +Y+SPQ C LCK EESV+HLFLHC F++ +W Sbjct: 145 GKVNTSDLVQRKRPFMYLSPQWCVLCKLCEESVDHLFLHCPFSLSLW 191