BLASTX nr result
ID: Sinomenium22_contig00055089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00055089 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270990.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_002270990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Vitis vinifera] gi|296087577|emb|CBI34833.3| unnamed protein product [Vitis vinifera] Length = 445 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 346 GGYMTANYLWDLMQAHKLNHSFPAKEAYYNMLK 248 GGY TANY+WDLMQA K+ SFPA EAYYN L+ Sbjct: 381 GGYTTANYIWDLMQARKITPSFPAVEAYYNGLR 413