BLASTX nr result
ID: Sinomenium22_contig00054937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00054937 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20032.1| Protein UXT-like protein [Morus notabilis] 73 5e-11 ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citr... 72 6e-11 ref|XP_002522491.1| protein binding protein, putative [Ricinus c... 70 4e-10 ref|XP_007045990.1| Prefoldin chaperone subunit family protein [... 68 1e-09 ref|XP_004158996.1| PREDICTED: protein UXT homolog [Cucumis sati... 68 1e-09 ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sati... 68 1e-09 ref|XP_006572821.1| PREDICTED: uncharacterized protein LOC100499... 68 2e-09 ref|NP_001237769.1| uncharacterized protein LOC100499907 [Glycin... 68 2e-09 ref|XP_004239102.1| PREDICTED: protein UXT homolog [Solanum lyco... 67 2e-09 ref|XP_006574924.1| PREDICTED: protein UXT homolog isoform X2 [G... 67 3e-09 ref|XP_006574923.1| PREDICTED: protein UXT homolog isoform X1 [G... 67 3e-09 ref|XP_006844830.1| hypothetical protein AMTR_s00058p00071840 [A... 66 4e-09 ref|XP_006348738.1| PREDICTED: protein UXT homolog [Solanum tube... 65 7e-09 ref|XP_007162661.1| hypothetical protein PHAVU_001G169600g [Phas... 63 4e-08 ref|XP_002312264.1| c-myc binding family protein [Populus tricho... 63 4e-08 ref|XP_002285690.1| PREDICTED: protein UXT homolog [Vitis vinife... 63 5e-08 ref|XP_007225011.1| hypothetical protein PRUPE_ppa020266mg [Prun... 62 6e-08 ref|XP_004297272.1| PREDICTED: protein UXT homolog isoform 2 [Fr... 62 1e-07 ref|XP_004297271.1| PREDICTED: protein UXT homolog isoform 1 [Fr... 62 1e-07 ref|XP_006657910.1| PREDICTED: protein UXT homolog isoform X1 [O... 60 3e-07 >gb|EXC20032.1| Protein UXT-like protein [Morus notabilis] Length = 265 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +2 Query: 287 VQS*MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQK 415 V++ MDSYR+ K+ +FEEFVDRRLKPDL+RAIAERDKVFEQQK Sbjct: 73 VRTEMDSYRQEKIQKFEEFVDRRLKPDLIRAIAERDKVFEQQK 115 >ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|567892483|ref|XP_006438762.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|568859128|ref|XP_006483094.1| PREDICTED: protein UXT homolog isoform X1 [Citrus sinensis] gi|568859130|ref|XP_006483095.1| PREDICTED: protein UXT homolog isoform X2 [Citrus sinensis] gi|557540957|gb|ESR52001.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|557540958|gb|ESR52002.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] Length = 151 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MDSYR+ KV +FEEFVDRRLKPDL RAIAERDKVFEQQK+ Sbjct: 1 MDSYRQEKVQKFEEFVDRRLKPDLTRAIAERDKVFEQQKI 40 >ref|XP_002522491.1| protein binding protein, putative [Ricinus communis] gi|223538376|gb|EEF39983.1| protein binding protein, putative [Ricinus communis] Length = 210 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 M+SYR+ K+ +FEEFVDRRLKPDLVRAIA+RDKVFE+QKV Sbjct: 1 MESYRQDKIQKFEEFVDRRLKPDLVRAIAQRDKVFEEQKV 40 >ref|XP_007045990.1| Prefoldin chaperone subunit family protein [Theobroma cacao] gi|508709925|gb|EOY01822.1| Prefoldin chaperone subunit family protein [Theobroma cacao] Length = 363 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 M+S R K+ +FEEFVDRRLKPDLVRAIAERDKVFEQQK+ Sbjct: 1 MESLRHEKIQKFEEFVDRRLKPDLVRAIAERDKVFEQQKI 40 >ref|XP_004158996.1| PREDICTED: protein UXT homolog [Cucumis sativus] Length = 155 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 302 DSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 D++R KV RFEEFVDRRLKPDLV AIAERDKVFEQQKV Sbjct: 6 DNFRHEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQKV 44 >ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sativus] Length = 155 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 302 DSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 D++R KV RFEEFVDRRLKPDLV AIAERDKVFEQQKV Sbjct: 6 DNFRHEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQKV 44 >ref|XP_006572821.1| PREDICTED: uncharacterized protein LOC100499907 isoform X2 [Glycine max] Length = 136 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MDS R+ KV RFEEFVD+RLKPDLV AIA+RDKVFEQQK+ Sbjct: 1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKI 40 >ref|NP_001237769.1| uncharacterized protein LOC100499907 [Glycine max] gi|571433258|ref|XP_006572820.1| PREDICTED: uncharacterized protein LOC100499907 isoform X1 [Glycine max] gi|255627579|gb|ACU14134.1| unknown [Glycine max] Length = 151 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MDS R+ KV RFEEFVD+RLKPDLV AIA+RDKVFEQQK+ Sbjct: 1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKI 40 >ref|XP_004239102.1| PREDICTED: protein UXT homolog [Solanum lycopersicum] Length = 146 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MD+ ++ KV RFEEF+DRRLKPDLV AIAERDKVFEQQK+ Sbjct: 1 MDTIKQEKVRRFEEFIDRRLKPDLVHAIAERDKVFEQQKI 40 >ref|XP_006574924.1| PREDICTED: protein UXT homolog isoform X2 [Glycine max] Length = 151 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MD+ R+ KV RFEEFVD+RLKPDLV AIA+RDKVFEQQK+ Sbjct: 1 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKI 40 >ref|XP_006574923.1| PREDICTED: protein UXT homolog isoform X1 [Glycine max] Length = 161 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MD+ R+ KV RFEEFVD+RLKPDLV AIA+RDKVFEQQK+ Sbjct: 1 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKI 40 >ref|XP_006844830.1| hypothetical protein AMTR_s00058p00071840 [Amborella trichopoda] gi|548847321|gb|ERN06505.1| hypothetical protein AMTR_s00058p00071840 [Amborella trichopoda] Length = 152 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MDS R+ KV +FEEFVDRRLKPDLV AIAERDKVF QQKV Sbjct: 11 MDSVRKEKVHKFEEFVDRRLKPDLVHAIAERDKVFAQQKV 50 >ref|XP_006348738.1| PREDICTED: protein UXT homolog [Solanum tuberosum] Length = 146 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 M++ ++ KV RFEEF+DRRLKPDLV AIAERDKVFEQQK+ Sbjct: 1 MNTIKQEKVRRFEEFIDRRLKPDLVHAIAERDKVFEQQKI 40 >ref|XP_007162661.1| hypothetical protein PHAVU_001G169600g [Phaseolus vulgaris] gi|561036125|gb|ESW34655.1| hypothetical protein PHAVU_001G169600g [Phaseolus vulgaris] Length = 151 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MDS R+ KV +FEEFVD+RLKPDL+ AI +RDKVFEQQK+ Sbjct: 1 MDSSRQDKVRKFEEFVDKRLKPDLIHAINQRDKVFEQQKI 40 >ref|XP_002312264.1| c-myc binding family protein [Populus trichocarpa] gi|118482164|gb|ABK93012.1| unknown [Populus trichocarpa] gi|222852084|gb|EEE89631.1| c-myc binding family protein [Populus trichocarpa] Length = 151 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MDSY + K+ +FEEFVD LKP LVRAIAERDKVFEQQK+ Sbjct: 1 MDSYIQEKIHKFEEFVDGHLKPQLVRAIAERDKVFEQQKI 40 >ref|XP_002285690.1| PREDICTED: protein UXT homolog [Vitis vinifera] gi|297746436|emb|CBI16492.3| unnamed protein product [Vitis vinifera] Length = 144 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 MD + KV RFEEFVDRRLKPDLV AIAERDKVFE+Q+V Sbjct: 1 MDGLIQQKVQRFEEFVDRRLKPDLVHAIAERDKVFERQEV 40 >ref|XP_007225011.1| hypothetical protein PRUPE_ppa020266mg [Prunus persica] gi|462421947|gb|EMJ26210.1| hypothetical protein PRUPE_ppa020266mg [Prunus persica] Length = 151 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 M+S+ + K+ ++EEFVD RLKPDLVRAIA+RDKVFEQQKV Sbjct: 1 MESHLQHKIQKYEEFVDGRLKPDLVRAIAQRDKVFEQQKV 40 >ref|XP_004297272.1| PREDICTED: protein UXT homolog isoform 2 [Fragaria vesca subsp. vesca] Length = 151 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 M+SYR+ K+ + EEFVD RLKPDLV+ IA+RDKVFE+QKV Sbjct: 1 MESYRQQKIQKLEEFVDGRLKPDLVQTIAQRDKVFEKQKV 40 >ref|XP_004297271.1| PREDICTED: protein UXT homolog isoform 1 [Fragaria vesca subsp. vesca] Length = 152 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 299 MDSYREAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQKV 418 M+SYR+ K+ + EEFVD RLKPDLV+ IA+RDKVFE+QKV Sbjct: 1 MESYRQQKIQKLEEFVDGRLKPDLVQTIAQRDKVFEKQKV 40 >ref|XP_006657910.1| PREDICTED: protein UXT homolog isoform X1 [Oryza brachyantha] gi|573951251|ref|XP_006657911.1| PREDICTED: protein UXT homolog isoform X2 [Oryza brachyantha] Length = 147 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 311 REAKVLRFEEFVDRRLKPDLVRAIAERDKVFEQQK 415 R+ KV +FEEFVDRRLKPDLV AIA+RDKVF+QQK Sbjct: 9 RQEKVRKFEEFVDRRLKPDLVNAIAQRDKVFQQQK 43