BLASTX nr result
ID: Sinomenium22_contig00054716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00054716 (880 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15771.3| unnamed protein product [Vitis vinifera] 61 5e-07 ref|XP_002281018.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-07 >emb|CBI15771.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 61.2 bits (147), Expect = 5e-07 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -3 Query: 878 RKRPGCSFVEINGAVHEFFVADLSHPQTDKIYETVFSISINSLLHFEG 735 +K+PGCSFVEI+G VHE FVAD SHP+ IYET+ ISIN L +G Sbjct: 380 KKQPGCSFVEIDGLVHELFVADRSHPEMGAIYETM--ISINKALQSKG 425 >ref|XP_002281018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 624 Score = 61.2 bits (147), Expect = 5e-07 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -3 Query: 878 RKRPGCSFVEINGAVHEFFVADLSHPQTDKIYETVFSISINSLLHFEG 735 +K+PGCSFVEI+G VHE FVAD SHP+ IYET+ ISIN L +G Sbjct: 568 KKQPGCSFVEIDGLVHELFVADRSHPEMGAIYETM--ISINKALQSKG 613