BLASTX nr result
ID: Sinomenium22_contig00054387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00054387 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26042.1| hypothetical protein MIMGU_mgv1a000732mg [Mimulus... 64 3e-08 gb|EYU26041.1| hypothetical protein MIMGU_mgv1a000732mg [Mimulus... 64 3e-08 ref|XP_007220909.1| hypothetical protein PRUPE_ppa000710mg [Prun... 63 5e-08 sp|Q4JF75.1|RBR_SCUBA RecName: Full=Retinoblastoma-related prote... 63 5e-08 sp|Q8H252.1|RBR_COCNU RecName: Full=Retinoblastoma-related prote... 63 5e-08 ref|XP_006598087.1| PREDICTED: retinoblastoma-related protein 1-... 62 1e-07 ref|XP_006594366.1| PREDICTED: retinoblastoma-related protein 1-... 62 1e-07 ref|XP_004511054.1| PREDICTED: retinoblastoma-related protein 1-... 61 1e-07 ref|XP_006432412.1| hypothetical protein CICLE_v10000128mg [Citr... 61 2e-07 ref|XP_006432410.1| hypothetical protein CICLE_v10000128mg [Citr... 61 2e-07 ref|XP_006432409.1| hypothetical protein CICLE_v10000128mg [Citr... 61 2e-07 ref|XP_004307078.1| PREDICTED: retinoblastoma-related protein-li... 61 2e-07 ref|XP_006465771.1| PREDICTED: retinoblastoma-related protein-li... 60 2e-07 sp|Q9SLZ4.1|RBR1_PEA RecName: Full=Retinoblastoma-related protei... 60 4e-07 ref|XP_002529988.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_003522419.1| PREDICTED: retinoblastoma-related protein 1-... 59 7e-07 ref|XP_007133695.1| hypothetical protein PHAVU_011G201200g [Phas... 59 9e-07 ref|XP_007133694.1| hypothetical protein PHAVU_011G201200g [Phas... 59 9e-07 ref|XP_007010834.1| Retinoblastoma-related 1 [Theobroma cacao] g... 59 9e-07 emb|CBI20795.3| unnamed protein product [Vitis vinifera] 59 9e-07 >gb|EYU26042.1| hypothetical protein MIMGU_mgv1a000732mg [Mimulus guttatus] Length = 996 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 +Y TS+DEL+KTME+AN LI +IL KKPC SE K ENL+NIIT Sbjct: 258 MYETSEDELKKTMEKANSLIADILSKKPCLASERKPENLENIIT 301 >gb|EYU26041.1| hypothetical protein MIMGU_mgv1a000732mg [Mimulus guttatus] Length = 1000 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 +Y TS+DEL+KTME+AN LI +IL KKPC SE K ENL+NIIT Sbjct: 258 MYETSEDELKKTMEKANSLIADILSKKPCLASERKPENLENIIT 301 >ref|XP_007220909.1| hypothetical protein PRUPE_ppa000710mg [Prunus persica] gi|462417371|gb|EMJ22108.1| hypothetical protein PRUPE_ppa000710mg [Prunus persica] Length = 1026 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 IY TS+DELR TME AN LI +ILKKKPCS SE K ENL+N+ Sbjct: 277 IYDTSEDELRNTMEMANALIADILKKKPCSASECKHENLENM 318 >sp|Q4JF75.1|RBR_SCUBA RecName: Full=Retinoblastoma-related protein gi|70568829|dbj|BAE06273.1| retinoblastoma [Scutellaria baicalensis] Length = 1006 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 +Y TS+DELRKT+E+AN LI +ILKKKPC SE K NL+NI+T Sbjct: 260 MYGTSEDELRKTLEKANNLITDILKKKPCLASECKPANLENIVT 303 >sp|Q8H252.1|RBR_COCNU RecName: Full=Retinoblastoma-related protein gi|23429044|gb|AAM77469.1| retinoblastoma-like protein [Cocos nucifera] Length = 1011 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 4 YHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 YHTS+DELR+ ME+AN LIV+ILKKKPC+ SE K ENL I T Sbjct: 268 YHTSEDELRRVMEKANNLIVDILKKKPCAASECKRENLAYINT 310 >ref|XP_006598087.1| PREDICTED: retinoblastoma-related protein 1-like [Glycine max] Length = 1005 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 IY+TS+DELRKTME+AN +I +ILKK+PC SE + ENL+NI Sbjct: 255 IYNTSEDELRKTMEKANNVIADILKKQPCLASECETENLENI 296 >ref|XP_006594366.1| PREDICTED: retinoblastoma-related protein 1-like [Glycine max] Length = 1014 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 IY+TS+DELRKTME+AN +I +ILKK+PC SE + ENL+NI Sbjct: 265 IYNTSEDELRKTMEKANNVIADILKKQPCLASECETENLENI 306 >ref|XP_004511054.1| PREDICTED: retinoblastoma-related protein 1-like [Cicer arietinum] Length = 1028 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 4 YHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDN 123 Y+TS+DELRKTME+AN LI +ILKKKPC SE + ENL+N Sbjct: 268 YNTSEDELRKTMEKANNLIADILKKKPCLASECETENLEN 307 >ref|XP_006432412.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|557534534|gb|ESR45652.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] Length = 957 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 IY TS+D+LRK ME+ N LI +ILKKKPC SE K ENL+NI T Sbjct: 202 IYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKSENLENIDT 245 >ref|XP_006432410.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|567879705|ref|XP_006432411.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|557534532|gb|ESR45650.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|557534533|gb|ESR45651.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] Length = 912 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 IY TS+D+LRK ME+ N LI +ILKKKPC SE K ENL+NI T Sbjct: 157 IYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKSENLENIDT 200 >ref|XP_006432409.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] gi|557534531|gb|ESR45649.1| hypothetical protein CICLE_v10000128mg [Citrus clementina] Length = 1024 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 IY TS+D+LRK ME+ N LI +ILKKKPC SE K ENL+NI T Sbjct: 269 IYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKSENLENIDT 312 >ref|XP_004307078.1| PREDICTED: retinoblastoma-related protein-like [Fragaria vesca subsp. vesca] Length = 1026 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIITG*LKF 147 IY TS++ELRKTME+AN LI ++LKKKPC SE K ENL NI T L + Sbjct: 276 IYDTSEEELRKTMEKANTLISDLLKKKPCLASECKNENLKNIDTDGLTY 324 >ref|XP_006465771.1| PREDICTED: retinoblastoma-related protein-like [Citrus sinensis] Length = 1024 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 IY TS+D+LRK ME+ N LI +ILKKKPC SE K ENL+NI T Sbjct: 269 IYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKNENLENIDT 312 >sp|Q9SLZ4.1|RBR1_PEA RecName: Full=Retinoblastoma-related protein 1; Short=PsRB1 gi|6681366|dbj|BAA88690.1| retinoblastoma-related protein [Pisum sativum] Length = 1026 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDN 123 +Y+TS+DELRKT+E+AN L+ +ILKKKPC SE + ENL+N Sbjct: 267 LYNTSEDELRKTIEQANNLVADILKKKPCLASECETENLEN 307 >ref|XP_002529988.1| conserved hypothetical protein [Ricinus communis] gi|254789790|sp|B9SVG9.1|RBR_RICCO RecName: Full=Retinoblastoma-related protein gi|223530511|gb|EEF32393.1| conserved hypothetical protein [Ricinus communis] Length = 1020 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +1 Query: 4 YHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 Y TS+DELRKTME+ N LI +ILKKKP SE K ENLDNI T Sbjct: 267 YDTSEDELRKTMEKTNNLIADILKKKPHMASEYKNENLDNINT 309 >ref|XP_003522419.1| PREDICTED: retinoblastoma-related protein 1-like isoform X1 [Glycine max] Length = 1014 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 IY+TS+DELRKTME+AN +I +ILKK+PC SE + NL+NI Sbjct: 265 IYNTSEDELRKTMEKANNVIADILKKQPCLASECETGNLENI 306 >ref|XP_007133695.1| hypothetical protein PHAVU_011G201200g [Phaseolus vulgaris] gi|561006695|gb|ESW05689.1| hypothetical protein PHAVU_011G201200g [Phaseolus vulgaris] Length = 1014 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 I +T++DELRKTME+AN +I +ILKKKPC SE + ENL+NI Sbjct: 264 ICNTTEDELRKTMEKANNVIADILKKKPCLASECETENLENI 305 >ref|XP_007133694.1| hypothetical protein PHAVU_011G201200g [Phaseolus vulgaris] gi|561006694|gb|ESW05688.1| hypothetical protein PHAVU_011G201200g [Phaseolus vulgaris] Length = 1012 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 I +T++DELRKTME+AN +I +ILKKKPC SE + ENL+NI Sbjct: 264 ICNTTEDELRKTMEKANNVIADILKKKPCLASECETENLENI 305 >ref|XP_007010834.1| Retinoblastoma-related 1 [Theobroma cacao] gi|508727747|gb|EOY19644.1| Retinoblastoma-related 1 [Theobroma cacao] Length = 1011 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNIIT 132 +Y S+D+LRKTME AN L+ +ILKKKPCS SE K E L+NI T Sbjct: 263 MYDASEDDLRKTMEMANKLVEDILKKKPCSASEFKTETLENIDT 306 >emb|CBI20795.3| unnamed protein product [Vitis vinifera] Length = 1006 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 1 IYHTSKDELRKTMERANGLIVNILKKKPCSVSEVKMENLDNI 126 IY TS+DE+RKTME+ N +IV+ILKKKPC SE K ENL +I Sbjct: 261 IYETSEDEVRKTMEQTNKVIVDILKKKPCLASECKSENLASI 302