BLASTX nr result
ID: Sinomenium22_contig00054322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00054322 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU21189.1| unknown [Glycine max] 57 2e-06 gb|EYU22393.1| hypothetical protein MIMGU_mgv1a015739mg [Mimulus... 56 6e-06 >gb|ACU21189.1| unknown [Glycine max] Length = 84 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 IFLLHVCRPDTRHIFVDVGLGFHVEFTWAEALN 3 + LL RPDT+HIFVDVG GFHVEFTW+EALN Sbjct: 1 MLLLSGTRPDTQHIFVDVGFGFHVEFTWSEALN 33 >gb|EYU22393.1| hypothetical protein MIMGU_mgv1a015739mg [Mimulus guttatus] Length = 147 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 77 PDTRHIFVDVGLGFHVEFTWAEALN 3 PDTRHIF+DVGLGFHVEFTW+EALN Sbjct: 73 PDTRHIFLDVGLGFHVEFTWSEALN 97