BLASTX nr result
ID: Sinomenium22_contig00053385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00053385 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374401.1| hypothetical protein POPTR_0015s06830g [Popu... 57 3e-06 >ref|XP_006374401.1| hypothetical protein POPTR_0015s06830g [Populus trichocarpa] gi|550322163|gb|ERP52198.1| hypothetical protein POPTR_0015s06830g [Populus trichocarpa] Length = 584 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/66 (48%), Positives = 39/66 (59%) Frame = +3 Query: 30 PLFLNLSADALDAYNEAYEEFNGKNAKDEDDHSFKAYKSNQFNIEKLDPLDHSVFWGQDG 209 PL +NLS +ALDAYNEAYEE N N +E+D ++ NQ L D V WGQ+ Sbjct: 439 PLVMNLSREALDAYNEAYEELNKMNESEEEDSLSGDFEDNQAG---LHLFDQRVSWGQN- 494 Query: 210 GEHNGS 227 G NGS Sbjct: 495 GRANGS 500