BLASTX nr result
ID: Sinomenium22_contig00053219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00053219 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX94019.1| hypothetical chloroplast RF19 (chloroplast) [Lede... 39 1e-05 >gb|AEX94019.1| hypothetical chloroplast RF19 (chloroplast) [Ledebouria cordifolia] Length = 1802 Score = 38.5 bits (88), Expect(2) = 1e-05 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 5/41 (12%) Frame = -1 Query: 460 VFHTENKDGNFCQFLDD-----TNRNTFHKFKFFIWPNYQI 353 +F +NK N QFL++ T+ N F KFK F+WPNY++ Sbjct: 1729 IFCNQNKIKNCGQFLNEEKYLNTDANKFIKFKLFLWPNYRL 1769 Score = 36.2 bits (82), Expect(2) = 1e-05 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 333 WFDTNTGSHVSMSRIHV 283 WFDTN GSH SMSRIH+ Sbjct: 1779 WFDTNNGSHFSMSRIHM 1795