BLASTX nr result
ID: Sinomenium22_contig00053172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00053172 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284247.1| PREDICTED: uncharacterized protein LOC100250... 42 6e-07 >ref|XP_002284247.1| PREDICTED: uncharacterized protein LOC100250827 [Vitis vinifera] Length = 360 Score = 42.0 bits (97), Expect(2) = 6e-07 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = +3 Query: 3 RDRGRFDRPLPPEWGPRDRERRSYGVRNERR 95 R+R +FDRP PP+WG RDR R S+ NER+ Sbjct: 265 RERNKFDRPAPPDWGHRDRGRDSF-FNNERK 294 Score = 37.0 bits (84), Expect(2) = 6e-07 Identities = 22/47 (46%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +1 Query: 163 GADCR*EADGPP---PPHKDRRRDSFVDRERDSRWGMASDRFDEHPY 294 G D R + P PP KD RRD ++ R RD R G+ DRF E PY Sbjct: 315 GRDVRARSRSPVRGGPPLKDYRRDMYMGRGRDDRHGIRRDRFGE-PY 360