BLASTX nr result
ID: Sinomenium22_contig00053110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00053110 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535170.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 >ref|XP_002535170.1| conserved hypothetical protein [Ricinus communis] gi|255598352|ref|XP_002536987.1| conserved hypothetical protein [Ricinus communis] gi|223517891|gb|EEF25396.1| conserved hypothetical protein [Ricinus communis] gi|223523842|gb|EEF27215.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 358 VSQRQQKGGGNGRLYSESMSELASAKMIIDAG 263 VSQRQQKGGG+GRLYSESMSELASAK +IDAG Sbjct: 72 VSQRQQKGGGDGRLYSESMSELASAKRLIDAG 103